DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and dpep2

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_017948963.1 Gene:dpep2 XenbaseID:XB-GENE-6073530 Length:431 Species:Xenopus tropicalis

Alignment Length:378 Identity:113/379 (30%)
Similarity:191/379 (50%) Gaps:57/379 (15%)


  Fly   109 SSSLLEARLAFIRRLLTESPLIEG--------------SWKPPSTMSLNS--SNLFEVRQNHIGA 157
            :.|.||.|   ..||:.:||||:|              .....:...|||  :|:.:::..::||
 Frog    32 NDSELELR---TMRLMKQSPLIDGHNDFALQIRRLYQNKLSRINLRILNSTRTNIKKLKDGYVGA 93

  Fly   158 VLWPIAVPCGAQYLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVAVLMGISGGH 222
            ..|...|.|.:|..|||:|.||.||..||:....|.:.:|.|::.:..|   .::|.|:|:.|||
 Frog    94 QFWSAYVLCSSQDKDAVRLALEQIDVIKRMCNEYDELELVTSSEGIVNT---SKLACLIGVEGGH 155

  Fly   223 ALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEENV--TNSFNEFGQTMLFEMN 285
            |:.:|...||..|.||.|::.:|. .|.||||..:    .|.|..:.  |.|..:||:.::.|||
 Frog   156 AIDSSLGTLRMFYDLGVRYMGLTH-TCNTPWAETS----SYGVHSSYQDTKSLTDFGKEVVKEMN 215

  Fly   286 RLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNL 350
            |:||::::|..|......||..:||||:.:::...::||.:.  :|||.:|..:.:|.|::::|.
 Frog   216 RIGMIIDLSHTSFNTSREVLNISKAPVIFSHSAAFALCNINR--NIPDDILKGIKKNKGLVMVNF 278

  Fly   351 E----RCGDRTLGVREAITAINYVRKVAGVDHIGLGG-------------APKSYALLLAELARD 398
            .    .| .:|..:.:.....:|:..:||...:|:||             .|..|..|:.||.| 
 Frog   279 HTQFVAC-QKTANISDVADHFDYISSIAGFQSVGIGGDYDGVNGFPRGLEDPSKYPSLIQELLR- 341

  Fly   399 RVWGNAAIKKLVGGNVMRILREIETLKNRLPLY----EEWIPHESIESNSYCR 447
            |.|.:..::.::..|.:|:.||:|.:::. .:|    ||.|..:  |.|..||
 Frog   342 RGWKDNELEGVLRANFLRVFREVEKVRDE-QIYMKPSEEEISAD--ELNYSCR 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 99/333 (30%)
dpep2XP_017948963.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.780

Return to query results.
Submit another query.