DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and dpep1

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_002933707.2 Gene:dpep1 XenbaseID:XB-GENE-6043566 Length:469 Species:Xenopus tropicalis

Alignment Length:438 Identity:122/439 (28%)
Similarity:225/439 (51%) Gaps:66/439 (15%)


  Fly    52 RCSNGGIPTYSSKKDSCSESSAERPERSRGRKILLGVGVVLVC-IAMAGGIPLALQLRSS-SLLE 114
            |.|...:.::.....|...|:||       .||....||.|:. :.......|.|.||:: |..|
 Frog    24 RISKVSVVSFKVSPTSLKVSTAE-------LKIKKATGVSLIIRMKQTFFFLLFLMLRTADSNRE 81

  Fly   115 ARLAFIRRLLTESPLIEG----SWKPPS------------TMSLNSSNLFEVRQNHIGAVLWPIA 163
            ..|    |::...|:|:|    .|:..|            |::...:|:.::|:..:|...|...
 Frog    82 EAL----RIMDSVPVIDGHNDLPWQLLSMFNNQLTKVDLRTLNNTHTNIPKLREGRVGGQFWAAY 142

  Fly   164 VPCGAQYLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVAVLMGISGGHALGTST 228
            |||..|..|||..|||.||..:|:..|.....:.||..::.::....::|.|:|:.|||::.:|.
 Frog   143 VPCETQGKDAVTRTLEQIDVIQRMCKAYPDFLLAESVADINKSFQDNKIACLIGVEGGHSIDSSL 207

  Fly   229 AVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEEN----VTNSFNEFGQTMLFEMNRLGM 289
            ..||:.|.||.|::::|. .|.|||.      .::||::.    .:|..::||:::::|||||||
 Frog   208 GTLRTFYKLGVRYMTLTH-SCNTPWV------DNWLVDKGDEPAKSNGLSDFGKSVIWEMNRLGM 265

  Fly   290 LVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNLER-- 352
            :::::.:|:..|:..|:.:|||::.::::..|:||  :..::||.||.|:.:.||::::|...  
 Frog   266 ILDLAHVSKKTMMDALQFSKAPLIFSHSSAFSLCN--HYRNVPDDVLRLVKDKGGLVMVNFYNDF 328

  Fly   353 --CGDRTLGVREAITAINYVRKVAGVDHIGLG----GAPK---------SYALLLAELARDRVWG 402
              |..:. .:.......::::||||.:|:|.|    |.|:         .|..|:.||.: |.|.
 Frog   329 VTCSQQA-NISSVADHFDHIKKVAGFEHVGFGGDYDGVPRVPDGLQDVSKYPDLVVELLK-RGWS 391

  Fly   403 NAAIKKLVGGNVMRILREIETLKNRLPL---YEEWIPHESIESNSYCR 447
            .|.:|..:..|::|:...:|.::::|..   .:|.||::.|||:  ||
 Frog   392 EAELKAALANNLLRVFEGVERVRSQLAAEVPNDEPIPYKEIESD--CR 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 94/335 (28%)
dpep1XP_002933707.2 Peptidase_M19 85..408 CDD:279569 94/334 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.780

Return to query results.
Submit another query.