DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LPO and cd

Sequence 1:NP_006142.1 Gene:LPO HGNCID:6678 Length:712 Species:Homo sapiens
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:747 Identity:222/748 (30%)
Similarity:359/748 (48%) Gaps:101/748 (14%)


Human     7 LPALLASLILLQAAA----STTRAQTTRTSAISD-TVSQAKVQVNKAFLDSRTRLKTAMSSETPT 66
            ||...|:...||.||    ...:|.:....|:.| .:.:..:|.|:....|....::.  |..|.
  Fly    99 LPDEPAAEWALQQAALGHHDGAQAVSAGIKALGDREILEEGLQPNEVNTPSFRHYRSL--STNPE 161

Human    67 SRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCG----APA 127
            :|:|:              |.|.|..::...:.::.:.|.....|        .:|.|    .|.
  Fly   162 ARKLA--------------RRGYVENQATIDIAKRFNYTKQPGRS--------NIGWGPKIVLPD 204

Human   128 PVV---RCDPCSPYRTITGDCNNRRKP-ALGAANRALARWLPAEYEDGLSLPFGWTPGKTRNGFP 188
            |.|   .||..:.||..||.|||::.| ..||:.....|.:..:|.||::.|      :..:...
  Fly   205 PTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAP------RVSHHGR 263

Human   189 LPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCI-- 251
            ||.||:||.||.....|   .|.|.:::...:||.:|||:   ..|.|.:|:  :.:..:.|:  
  Fly   264 LPPARQVSLKIHRSSYE---TDSNFTVMLAVFGQFMDHDI---TATSLTTSQ--EGESIDCCVAA 320

Human   252 ---QGDNCFPIMFPPNDPKAGTQG-KCMPFFRAGFVCPTPPYKSLAREQINALTSFLDASFVYSS 312
               |...|:|:...|:||...... .||.|.|:   .|.|..:...|.|:|..|:|:|||.||.:
  Fly   321 TREQHPECYPVDILPDDPYYKQYNISCMNFVRS---APAPTGRFGPRMQLNQATAFIDASVVYGN 382

Human   313 EPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTTARVP--CFLAGDSRASE 375
            .....::||:..:.    ::...|:|.|...||..|.....|..:..| |:.  ||.:||.||:|
  Fly   383 LEQRQNQLRSFING----SLRMFVTDDGRQLLPISSNPADGCNRVQMT-RLGKYCFESGDDRANE 442

Human   376 HILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAFVQIITFRDYLPILLGDHMQ- 439
            ::||.:.|.|:.|.||.|||:|:..||.|:.|:|||||||||||.:..||:.::||:|||.::. 
  Fly   443 NLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISE 507

Human   440 -KWIPPYQ-------GYSESVDPRISNVF-TFAFRFGHLEVPSSMFRLDENYQPWGPEPE-LPLH 494
             |.:.|.:       .|...|||.|:|.| ..||||.|..:| .:|.:..:    ...|| :.||
  Fly   508 AKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLP-GLFNISRD----NSTPEAIELH 567

Human   495 TLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQPTHR----IHGFDLAAINT 555
            .:.||.:.:..:.|||..:  :.|..:.:|:.::..:.|:..|||:.|..    :.|.||.::|.
  Fly   568 KMLFNPFSLWAEHGIDHAL--MTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNI 630

Human   556 QRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGLYGTPDNIDIWIGAIAEPLVE 620
            ||.||||.|.|..:|..|.|....|.||::..:.:..| ..:..:|.:|.::|::.||::||.::
  Fly   631 QRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQDVDVYTGALSEPPLD 694

Human   621 RGRVGPLLACLLGKQFQQIRDGDRFWWE---NPGVFTNEQKDSLQKMSFSRLVCDN----TRITK 678
            ....||||:|::..||.:::.||..|:|   .|..||..|...:.|.|.:.::|.|    ||:.:
  Fly   695 GAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVRE 759

Human   679 VPRDPFWANSYPYDFVDCSAID--KLDLSPWA 708
            ...........|:  |||..::  ..:..||:
  Fly   760 HVMQRLRDGGNPH--VDCQDLEGFHFNFEPWS 789

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LPONP_006142.1 An_peroxidase 138..674 CDD:281139 185/567 (33%)
myeloperoxidase_like 283..694 CDD:188656 143/435 (33%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 185/567 (33%)
peroxinectin_like 364..750 CDD:188655 137/399 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.