DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and GAD1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_013976.1 Gene:GAD1 SGDID:S000004862 Length:585 Species:Saccharomyces cerevisiae

Alignment Length:462 Identity:91/463 (20%)
Similarity:149/463 (32%) Gaps:142/463 (31%)


  Fly    80 ELCQQVIHYSVKTSHGRFHNQLFGQLDPF--GLAGALVTEAMNGSTYTYEVAPVFSLIE-----T 137
            :|..|:||..: |..|..|..|...::.|  ..|..|:.|.:..:....:..|  .|||     .
Yeast    70 DLSYQLIHNEL-TLDGNPHLNLASFVNTFTTDQARKLIDENLTKNLADNDEYP--QLIELTQRCI 131

  Fly   138 EVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSF 202
            .::|.:......:|..|....|.|.:.|.|.:..:.:....:|.:|....:|.::.:| ....:.
Yeast   132 SMLAQLWHANPDEEPIGCATTGSSEAIMLGGLAMKKRWEHRMKNAGKDASKPNIIMSS-ACQVAL 195

  Fly   203 VKAANWLGLGSYNCVSVRTNERGQMLLD--DLEAKIAEAKARGGEPFFVNC--TAGTTVLGAFDD 263
            .|...:.   ...|..|..:.|...:||  .|...:.|..        :.|  ..|||..|..::
Yeast   196 EKFTRYF---EVECRLVPVSHRSHHMLDPESLWDYVDENT--------IGCFVILGTTYTGHLEN 249

  Fly   264 INGAADVTE----RHGLW------LHVDACLGGAAL--------LSA------------------ 292
            :...|||..    :|..|      :|.|...||..:        :.|                  
Yeast   250 VEKVADVLSQIEAKHPDWSNTDIPIHADGASGGFIIPFGFEKEHMKAYGMERWGFNHPRVVSMNT 314

  Fly   293 -----------------KNRSLIA-----------GLERANSFSWN----------------PHK 313
                             ::.||:|           |:|.....:::                .|.
Yeast   315 SGHKFGLTTPGLGWVLWRDESLLADELRFKLKYLGGVEETFGLNFSRPGFQVVHQYFNFVSLGHS 379

  Fly   314 TIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQ--QDKFYDVSYDTGNKSV----------QCGR 366
            ......|.|||:.|...  .|..||::....|:  ......:..|:..|||          :.|.
Yeast   380 GYRTQFQNSLFVARAFS--FELLNSSKLPGCFEIVSSIHESIENDSAPKSVKDYWEHPQAYKPGV 442

  Fly   367 KIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAM 431
            .:.|||    |..:.:.:|. .|..||     |...||.||    .:||.:.        :|||.
Yeast   443 PLVAFK----LSKKFHEEYP-EVPQAI-----LSSLLRGRG----WIIPNYP--------LPKAT 485

  Fly   432 RVSSEEE 438
            ..|.|:|
Yeast   486 DGSDEKE 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 85/446 (19%)
GAD1NP_013976.1 Glu-decarb-GAD 41..522 CDD:130848 91/463 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.