DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and DPL1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_010580.1 Gene:DPL1 SGDID:S000002702 Length:589 Species:Saccharomyces cerevisiae

Alignment Length:572 Identity:108/573 (19%)
Similarity:202/573 (35%) Gaps:190/573 (33%)


  Fly    22 WKILENVFHLLRKED--TFCVDPQKWDKQKIV------PFLQPDKLKELINLKVRETENCSLAEI 78
            :|::.|.|:||:...  ...|...:...:::.      |||:....||:..:| :..|:    |:
Yeast    66 YKLISNFFYLLKVYGPVRLAVRTYEHSSRRLFRWLLDSPFLRGTVEKEVTKVK-QSIED----EL 125

  Fly    79 EELCQQVIHYSVKTSHGRFHNQLFGQLDPFG------------LAGALV---TEAMNGSTYTYE- 127
            .....|::::....|:|...:.:..:|:...            ::||:.   .:.::..|..|| 
Yeast   126 IRSDSQLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEK 190

  Fly   128 ----------VAPVFSLIETEVIATICKL--AGYKEGDGIFAPGGSTSNMYGMVLAR-YKI---- 175
                      |.|....:|:||::.:.::  |....|.|....||:.|.:...:.|: |.:    
Yeast   191 YCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLLLACLSAKMYALHHRG 255

  Fly   176 --APEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAE 238
              .||:       :.|:.      :|..|.|||.:.|:      .:|..|     ||....::..
Yeast   256 ITEPEI-------IAPVT------AHAGFDKAAYYFGM------KLRHVE-----LDPTTYQVDL 296

  Fly   239 AKARGGEPFFVNCTAGTTVL----------GAFDDINGAADVTERHGLWLHVDACLGGAALLSAK 293
            .|.:.    |:|   ..|:|          |..|||.|...:.:::.|.||||:|||.       
Yeast   297 GKVKK----FIN---KNTILLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGS------- 347

  Fly   294 NRSLIAGLERA---------------NSFSWNPHKTIGAPLQCSLFLTRES-------------- 329
              .:::.:|:|               .|.|.:.||...||...|:.:.|.|              
Yeast   348 --FIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWT 410

  Fly   330 --------------GRLLERC-----NSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDA---FK 372
                          |.::..|     |..|..|:                 ..|...:.|   ||
Yeast   411 GGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYI-----------------ESCQEIVGAAMKFK 458

  Fly   373 FWLM-----LKARGYGKYGLM--VDHAIHIARLLEGKLRQRGDRFRLV------------IPEHE 418
            .::.     |...|..:|.::  ....::|..|.: :|.::|..|..:            :..|.
Yeast   459 KYIQENIPDLNIMGNPRYSVISFSSKTLNIHELSD-RLSKKGWHFNALQKPVALHMAFTRLSAHV 522

  Fly   419 YSNVCFWFIPKAMRVSSE---EETPEWWSRLYTVAPKIKEQMAHSGTLMIGY 467
            ...:|.........:.||   :.:|:..|.||.||..:| ....:..|::|:
Yeast   523 VDEICDILRTTVQELKSESNSKPSPDGTSALYGVAGSVK-TAGVADKLIVGF 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 91/490 (19%)
DPL1NP_010580.1 GadA 106..543 CDD:223154 91/500 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.