DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and EMB1075

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_175036.1 Gene:EMB1075 AraportID:AT1G43710 Length:482 Species:Arabidopsis thaliana

Alignment Length:404 Identity:98/405 (24%)
Similarity:157/405 (39%) Gaps:77/405 (19%)


  Fly    88 YSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEG 152
            |::...:|     ..|||..|.:..  :.:....|.|.....|    .|..|:....:|...:..
plant   111 YNLDFDYG-----ALGQLQHFSINN--LGDPFIESNYGVHSRP----FEVGVLDWFARLWEIERD 164

  Fly   153 D--GIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYN 215
            |  |.....|:..|::|:::.|     |:...|       :|:.|.|||||..|||....:   .
plant   165 DYWGYITNCGTEGNLHGILVGR-----EMFPDG-------ILYASRESHYSVFKAARMYRM---E 214

  Fly   216 CVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHG----- 275
            |..|.|...|::..|||..|:.   |...:|..:|...||||.||.||::......|..|     
plant   215 CEKVDTLMSGEIDCDDLRKKLL---ANKDKPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDR 276

  Fly   276 LWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTR-ESGRLLERCNST 339
            .::|.|..|.|..:...|....:...:...|.|.:.||.:|.|:.|.:.:|| |..::|    |:
plant   277 FYIHCDGALFGLMMPFVKRAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL----SS 337

  Fly   340 EAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKF-WLMLKARGYGKYGLMVDHAIHIARLLEGKL 403
            ...||..:|           .::...|...|..| |..|..:||..:...|...:..|..|:.:|
plant   338 NVEYLASRD-----------ATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRL 391

  Fly   404 RQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTL--MIG 466
            |:.|....|    :|.|:...:..||      :||....|            |:|..|.:  ::.
plant   392 REAGISAML----NELSSTVVFERPK------DEEFVRRW------------QLACQGDIAHVVV 434

  Fly   467 YSPLKAKNLGNFFR 480
            ...:..:.|.||.:
plant   435 MPSVTIEKLDNFLK 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 96/396 (24%)
EMB1075NP_175036.1 PLN02263 15..482 CDD:177904 98/405 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D810772at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.