DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and TYRDC

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001329473.1 Gene:TYRDC AraportID:AT4G28680 Length:566 Species:Arabidopsis thaliana

Alignment Length:510 Identity:116/511 (23%)
Similarity:210/511 (41%) Gaps:102/511 (20%)


  Fly    31 LLRKEDTFCVD------------PQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAE-IEELC 82
            |||::....||            ||.:   .::..:||..|::::.....|... ||.| ::::.
plant    55 LLREQGHIMVDFIADYYKNLQDSPQDF---PVLSQVQPGYLRDMLPDSAPERPE-SLKELLDDVS 115

  Fly    83 QQVI-------------HYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSL 134
            ::::             :|:..||..             |..|.::...::...:|:..:|..:.
plant   116 KKIMPGITHWQSPSYFAYYASSTSVA-------------GFLGEMLNAGLSVVGFTWLTSPAATE 167

  Fly   135 IETEVIATICKL---------AGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPL 190
            :|..|:..:.||         .|...|.|:....|..:.:..::.||.:|   :|..|...:..|
plant   168 LEIIVLDWLAKLLQLPDHFLSTGKGNGGGVIQGTGCEAVLVVVLAARDRI---LKKVGKTLLPQL 229

  Fly   191 VLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQ--MLLDDLEAKIAEAKARGGEPFFVNCTA 253
            |::.||::|.||.||....|:...|...::|:....  |..:.||..|:...|:|..|||:..|.
plant   230 VVYGSDQTHSSFRKACLIGGIHEENIRLLKTDSSTNYGMPPESLEEAISHDLAKGFIPFFICATV 294

  Fly   254 GTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAP 318
            |||...|.|.:....::.:::|:||||||...|.|.:..:.|..|.|:|.|:||:.|.||.:.|.
plant   295 GTTSSAAVDPLVPLGNIAKKYGIWLHVDAAYAGNACICPEYRKFIDGIENADSFNMNAHKWLFAN 359

  Fly   319 LQCSLFLTRESGRLLERCNSTEAHYLFQQDK-------------------FYDVSYDT------- 357
            ..||....::...|::...:...:..|:..|                   |:...:|.       
plant   360 QTCSPLWVKDRYSLIDALKTNPEYLEFKVSKKDTVVNYKDWQISLSRRFRFFISPFDVVFAGPIS 424

  Fly   358 -GNKSVQCGRKIDAFKFWLMLKARGYGKYGL---MVDHAIHIARLLEGKLRQRGDRFRLVIPEHE 418
             .|..|.......:.|.|::|  |.||...|   :.|| :::|:..|..:.|  |....|:....
plant   425 LTNLYVHAFDLYRSLKLWMVL--RLYGSENLRNFIRDH-VNLAKHFEDYVAQ--DPSFEVVTTRY 484

  Fly   419 YSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAK 473
            :|.|||...|    |..:|:.....:|      ::...:..:|.:.|.::.|..|
plant   485 FSLVCFRLAP----VDGDEDQCNERNR------ELLAAVNSTGKIFISHTALSGK 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 99/419 (24%)
TYRDCNP_001329473.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D810772at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.