DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and AAS

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_849999.1 Gene:AAS AraportID:AT2G20340 Length:490 Species:Arabidopsis thaliana

Alignment Length:501 Identity:108/502 (22%)
Similarity:195/502 (39%) Gaps:98/502 (20%)


  Fly     6 DGAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRET 70
            |..||:||:.|.:..  |||..|.|              |.......:.               .
plant    59 DHPETLDQVLDDVRA--KILPGVTH--------------WQSPSFFAYY---------------P 92

  Fly    71 ENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLI 135
            .|.|:|                                |..|.:::..:....:::..:|..:.:
plant    93 SNSSVA--------------------------------GFLGEMLSAGLGIVGFSWVTSPAATEL 125

  Fly   136 ETEVIATICKLAGYKE-------GDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLF 193
            |..|:..:.||....|       |.|:.....|.:.:..::.||.|:   :::.|...:..||::
plant   126 EMIVLDWVAKLLNLPEQFMSKGNGGGVIQGSASEAVLVVLIAARDKV---LRSVGKNALEKLVVY 187

  Fly   194 TSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLL--DDLEAKIAEAKARGGEPFFVNCTAGTT 256
            :||::|.:..||....|:...||..:.|:......|  :.|:..::.....|..|||:....|||
plant   188 SSDQTHSALQKACQIAGIHPENCRVLTTDSSTNYALRPESLQEAVSRDLEAGLIPFFLCANVGTT 252

  Fly   257 VLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQC 321
            ...|.|.:.....:...:|:|.||||...|:|.:..:.|..|.|:|.|:||:.|.||.......|
plant   253 SSTAVDPLAALGKIANSNGIWFHVDAAYAGSACICPEYRQYIDGVETADSFNMNAHKWFLTNFDC 317

  Fly   322 SLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYG 386
            ||...::... |....||...:|..:....::..|..:..:..||:..:.|.|::|:..|.....
plant   318 SLLWVKDQDS-LTLALSTNPEFLKNKASQANLVVDYKDWQIPLGRRFRSLKLWMVLRLYGSETLK 381

  Fly   387 LMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAP 451
            ..:.:.|.:|:..| :|..:...|.:|.| ..::.|||..:|    |..||:.....:|      
plant   382 SYIRNHIKLAKEFE-QLVSQDPNFEIVTP-RIFALVCFRLVP----VKDEEKKCNNRNR------ 434

  Fly   452 KIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTC---FPILKSKEL 494
            ::.:.:..||.|.:.::.|..|       :|..|   .|:.:.|.:
plant   435 ELLDAVNSSGKLFMSHTALSGK-------IVLRCAIGAPLTEEKHV 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 93/411 (23%)
AASNP_849999.1 PLN02880 3..490 CDD:215475 108/502 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.850 Consistency score
10.910

Return to query results.
Submit another query.