| Sequence 1: | NP_649211.1 | Gene: | CG5618 / 40241 | FlyBaseID: | FBgn0036975 | Length: | 510 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_849999.1 | Gene: | AAS / 816553 | AraportID: | AT2G20340 | Length: | 490 | Species: | Arabidopsis thaliana |
| Alignment Length: | 501 | Identity: | 108/501 - (21%) |
|---|---|---|---|
| Similarity: | 195/501 - (38%) | Gaps: | 98/501 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 DGAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRET 70
Fly 71 ENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLI 135
Fly 136 ETEVIATICKLAGYKE-------GDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLF 193
Fly 194 TSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLL--DDLEAKIAEAKARGGEPFFVNCTAGTT 256
Fly 257 VLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQC 321
Fly 322 SLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYG 386
Fly 387 LMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAP 451
Fly 452 KIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTC---FPILKSKEL 494 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5618 | NP_649211.1 | AAT_I | 97..504 | CDD:302748 | 93/410 (23%) |
| AAS | NP_849999.1 | PLN02880 | 3..490 | CDD:215475 | 108/501 (22%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0076 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||