DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Gadl1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_006512382.1 Gene:Gadl1 MGIID:1920998 Length:518 Species:Mus musculus

Alignment Length:513 Identity:241/514 (47%)
Similarity:340/514 (66%) Gaps:36/514 (7%)


  Fly     5 VDGAETVDQIRDGLMDDWK------------ILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPD 57
            |||.     :.:|...|.|            |:|.|  :|:..|.         .:|:..:..|:
Mouse    27 VDGV-----VLNGPQTDVKAGEKFVEEACRLIMEEV--VLKATDV---------NEKVCEWQPPE 75

  Fly    58 KLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGS 122
            :|::|::|::|:|.. |..::.:|||.|||:||||:|.||.|||:..||.:.||..::|||:|.|
Mouse    76 QLRQLLDLEMRDTGE-SQDKLLKLCQDVIHFSVKTNHPRFFNQLYAGLDYYSLAARIITEALNPS 139

  Fly   123 TYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGM 187
            .|||||:|||.|:|..|:..:.:..|:|||||||.||||.|||..|.||||:..|::|..|:.|:
Mouse   140 IYTYEVSPVFLLVEEAVLKKMIECVGWKEGDGIFNPGGSVSNMCAMNLARYRHCPDIKEKGLSGL 204

  Fly   188 RPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCT 252
            ..|:||||.|.|||..|||::||:|:.|...|.|:.||:|:.:|||.:|.:|:..|..||.|..|
Mouse   205 PRLILFTSAECHYSMKKAASFLGIGTQNVYFVETDGRGKMIPEDLEKQIWQARQEGAVPFLVCAT 269

  Fly   253 AGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGA 317
            :|||||||||.::..|:|.|||||||||||..||:||:|.|:|.|:.|:.||:|.:|||||.:.|
Mouse   270 SGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSALVSRKHRRLLHGIHRADSVAWNPHKMLMA 334

  Fly   318 PLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGY 382
            .:|||..|.::...||::|.|.:|.||||||||||||||||:||:||.|:.||||||:..||.|.
Mouse   335 GIQCSALLVKDKSDLLKKCYSAKATYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGT 399

  Fly   383 GKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLY 447
            ......|:.|..::|.|..::::| :.|:|:: |.||:|||||:||.::|  ..||.||:|.:|.
Mouse   400 SGLEERVNRAFALSRYLVDEIKKR-EGFKLLM-EPEYTNVCFWYIPPSLR--EMEEGPEFWRKLS 460

  Fly   448 TVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLG 505
            .|||.|||:|...|:||:||.|.:.|  .||||.| ...|.:..:::||:||||:.||
Mouse   461 LVAPAIKEKMMKKGSLMLGYQPHRGK--VNFFRQV-VISPQVSREDMDFLLDEIDSLG 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 208/407 (51%)
Gadl1XP_006512382.1 DOPA_deC_like 114..514 CDD:99743 208/407 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3597
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45677
Phylome 1 0.910 0.690 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.