DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and gadl1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_012820293.1 Gene:gadl1 XenbaseID:XB-GENE-5721903 Length:522 Species:Xenopus tropicalis

Alignment Length:504 Identity:230/505 (46%)
Similarity:331/505 (66%) Gaps:12/505 (2%)


  Fly     5 VDGAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRE 69
            |||......|.|....: |.:|:|:.:|..|..:....   ..||:..:.:|::||:|::|.:::
 Frog    31 VDGVVLNGPIIDSSSGE-KFVEDVYRILMNELVYKASD---INQKVCEWQEPEQLKKLLDLNIKD 91

  Fly    70 TENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSL 134
            ... ...::.:||:.||.|||||||.||.|||:..:|.:.||...:|||:|.|.|||||:|||.|
 Frog    92 NGE-PHEKLLQLCKNVIKYSVKTSHPRFFNQLYAGMDHYSLAARFITEALNPSVYTYEVSPVFIL 155

  Fly   135 IETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESH 199
            .|..::..:.:..|:|||||||:||||.||||.:.|||||..|::|..|:.....||:|||:|.|
 Frog   156 TEEAILKKMIEFLGWKEGDGIFSPGGSVSNMYAVNLARYKYCPDIKQKGLSSAPRLVMFTSEECH 220

  Fly   200 YSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDI 264
            ||..|||.:||:|:.|...|:|::||:|:.::||.:|..||.....||.|:.|:|||||||||.:
 Frog   221 YSMKKAAAFLGIGTENVYFVKTDDRGKMIPEELENQIQRAKKEAAVPFLVSATSGTTVLGAFDPL 285

  Fly   265 NGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRES 329
            :..|::.|:|.||.||||..||:||:|.|.|..:.|:.||:|.:|||||.:.|.:||...|.|::
 Frog   286 DDIANICEKHKLWFHVDASWGGSALMSQKYRKCLHGIHRADSVAWNPHKMLMAGIQCCALLVRDN 350

  Fly   330 GRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIH 394
            ..||:||:|.||.|||||||||||.||||:||:||.|:.||||||:|.||.|.......::.|:.
 Frog   351 SGLLKRCHSAEATYLFQQDKFYDVQYDTGDKSIQCSRRADAFKFWMMWKALGTTGLEERINRALA 415

  Fly   395 IARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAH 459
            :.|.|..::::| |.|.| :.|.||:|.|||:||.:.|  :.|:.||:|.:...|||.|||:|..
 Frog   416 LTRYLASEIKKR-DGFEL-LWEPEYANTCFWYIPPSFR--NMEKGPEYWRKFSNVAPTIKERMMK 476

  Fly   460 SGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            .|::|:||.|.:.|  .||||.: ...|.:..:::||:||||||||..:
 Frog   477 KGSMMVGYQPHRDK--VNFFRHI-VISPQVSREDMDFVLDEIERLGRDL 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 199/407 (49%)
gadl1XP_012820293.1 DOPA_deC_like 118..518 CDD:99743 199/407 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.