DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Csad

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_068518.1 Gene:Csad RGDID:621030 Length:493 Species:Rattus norvegicus

Alignment Length:461 Identity:228/462 (49%)
Similarity:322/462 (70%) Gaps:8/462 (2%)


  Fly    48 QKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAG 112
            :|:..:.:|::||:|::|:: :::..|...|.|.|:.||||||||.|.||.||||..|||..|||
  Rat    41 EKVCEWKEPEELKQLLDLEL-QSQGESRERILERCRAVIHYSVKTGHPRFFNQLFSGLDPHALAG 104

  Fly   113 ALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAP 177
            .::||::|.|.||||:||||.|:|.||:..:..|.|:..|||:|.||||.||||.:.|||::..|
  Rat   105 RIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNTGDGVFCPGGSISNMYAINLARFQRYP 169

  Fly   178 EVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKAR 242
            :.|..|:..:.||.||||.|.|||..|.|.:||||:.:...|:.:|||:|:.:|||.:|:.|:|.
  Rat   170 DCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGKMIPEDLERQISLAEAE 234

  Fly   243 GGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSF 307
            |..||.|:.|:|||||||||.::..|||.:||||||||||..||:.|||..:|.|:.|::||:|.
  Rat   235 GSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWLHVDAAWGGSVLLSRTHRHLLDGIQRADSV 299

  Fly   308 SWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFK 372
            :|||||.:.|.||||..|.|::..||:||:.::|.|||||||||:|:.|||:|.|||||::|..|
  Rat   300 AWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYNVALDTGDKVVQCGRRVDCLK 364

  Fly   373 FWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEE 437
            .|||.||:|.......:|.|..:.|.|..::::| :.|.||: |.|:.||||||:|.::|  .::
  Rat   365 LWLMWKAQGGQGLEWRIDQAFALTRYLVEEIKKR-EGFELVM-EPEFVNVCFWFVPPSLR--GKK 425

  Fly   438 ETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIE 502
            |:|::..||..|||.:||:|...||:||||.|...:  .|||||| ...|||...::||:|.|:|
  Rat   426 ESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTR--ANFFRMV-VANPILVQADIDFLLGELE 487

  Fly   503 RLGEKI 508
            |||:.:
  Rat   488 RLGQDL 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 206/407 (51%)
CsadNP_068518.1 DOPA_deC_like 89..489 CDD:99743 206/407 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45677
Phylome 1 0.910 0.690 Consistency score
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.