DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and gad2

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001017708.2 Gene:gad2 ZFINID:ZDB-GENE-030909-9 Length:583 Species:Danio rerio

Alignment Length:499 Identity:213/500 (43%)
Similarity:317/500 (63%) Gaps:21/500 (4%)


  Fly    16 DGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKLKELINLKVRETENCSLAEIE 79
            ||.......|:.|..:|.   .:.|  :.:|:. |::.|..|::|.:..|.::.: |..:|.:|.
Zfish   100 DGDAKTMNFLQEVVDILL---AYIV--ESFDRSTKVIDFHYPNELLQRNNWELSD-EPETLDDIL 158

  Fly    80 ELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATIC 144
            ..|:..:.|::||:|.|:.|||...||..|||...:|...|.:.:||||||||.|:|...:..:.
Zfish   159 ISCRATLKYAIKTAHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEVAPVFVLLEYVTLKKMR 223

  Fly   145 KLAGYKE--GDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAAN 207
            ::.|:::  |||||:|||:.||||.|:|||||:.||||..||..:..||.|||:.||:|..|.|.
Zfish   224 EIIGWQDGHGDGIFSPGGAISNMYAMLLARYKMFPEVKEKGMSSVPRLVAFTSEHSHFSIKKGAA 288

  Fly   208 WLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTE 272
            .||:|:.:.:.::.:|||:|:..|||.:|.|||.:|..||||:.||||||.||||.:...||:.:
Zfish   289 ALGIGTESVICIKADERGKMIPSDLERRIIEAKQKGYVPFFVSATAGTTVYGAFDPLIAIADICK 353

  Fly   273 RHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCN 337
            :|.:|:|||...||:.|:|.|:|..:.|:|||||.:|||||.:..|||||..|.||.| |::.||
Zfish   354 KHDVWMHVDGAWGGSLLMSRKHRWKLNGVERANSMTWNPHKMMAVPLQCSALLVREEG-LMQSCN 417

  Fly   338 STEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGK 402
            ..:|.|||||||.||:.||||:|::||||.:|.||.|||.:|:|...:...:|..:.::..|..|
Zfish   418 QMQACYLFQQDKHYDLQYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDKCLELSEYLYNK 482

  Fly   403 LRQRGDRFRLVI---PEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLM 464
            ::.| :.:::|.   |:|  :|||||::|..:|..  |:..|...||:.|||.||.:|...||.|
Zfish   483 IKDR-EGYQMVFDGKPQH--TNVCFWYLPPGVRYL--EDKVERMKRLHKVAPVIKARMMEYGTTM 542

  Fly   465 IGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            :.|.|...|  .||||||.: .|....:::||:::||||||:.:
Zfish   543 VSYQPQGDK--VNFFRMVIS-NPAATFEDIDFLIEEIERLGQDL 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 190/412 (46%)
gad2NP_001017708.2 Pyridoxal_deC 136..506 CDD:278699 171/375 (46%)
TIM_phosphate_binding 511..>561 CDD:304361 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.