DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and CSAD

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_024304779.1 Gene:CSAD HGNCID:18966 Length:620 Species:Homo sapiens

Alignment Length:546 Identity:233/547 (43%)
Similarity:325/547 (59%) Gaps:70/547 (13%)


  Fly    15 RDGLMDDWKILEN-------VFHLLRKEDTFCVDP--QKWD--KQKIVPFLQPDKLKELINLKVR 68
            |:.||.|.:.|.:       |..|||......||.  ||..  .||:..:.:|::||:|::|::|
Human    93 REILMADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELR 157

  Fly    69 ETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFS 133
             ::..|..:|.|.|:.||.|||||.|.||.||||..|||..|||.::||::|.|.||||:||||.
Human   158 -SQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFV 221

  Fly   134 LIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDES 198
            |:|.||:..:..|.|:..|||||.||||.||||.:.||||:..|:.|..|:..:.||.||||.| 
Human   222 LMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKE- 285

  Fly   199 HYSFVKAANWLGLGSYNCVS--VRTNERGQMLLDDLEAKIAE---------------------AK 240
                |...:....|....:|  |.|..|.::...||...::|                     .:
Human   286 ----VGKRHRPNPGLLILISSHVTTPSRRELRFWDLAPTVSEWSRLMREGKWSPRIWRGRLVWPR 346

  Fly   241 AR-------------GGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSA 292
            .|             |..||.|:.|:|||||||||.:...|||.:||||||||||..||:.|||.
Human   347 LRLTFHFFETFILDSGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQ 411

  Fly   293 KNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDT 357
            .:|.|:.|::||:|.:|||||.:.|.||||..|.:::..||:||:.::|.|||||||||||:.||
Human   412 THRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDT 476

  Fly   358 GNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNV 422
            |:|.|||||::|..|.|||.||:|.......:|.|..:||.|..::::| :.|.||: |.|:.||
Human   477 GDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKR-EGFELVM-EPEFVNV 539

  Fly   423 CFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMV----- 482
            ||||:|.::|  .::|:|::..||..|||.:||:|...|::||||.|...:  |||||:|     
Human   540 CFWFVPPSLR--GKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTR--GNFFRVVVANSA 600

  Fly   483 FTCFPILKSKELDFILDEIERLGEKI 508
            .||      .::||:|:|:||||:.:
Human   601 LTC------ADMDFLLNELERLGQDL 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 197/448 (44%)
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 197/448 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45677
Phylome 1 0.910 0.690 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.