DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and SEPSECS

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_016863766.1 Gene:SEPSECS HGNCID:30605 Length:586 Species:Homo sapiens

Alignment Length:515 Identity:101/516 (20%)
Similarity:171/516 (33%) Gaps:140/516 (27%)


  Fly    45 WDKQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFG 109
            ||:..:..||....:.:..|.    ..||.:.|.|   .:|....|...|.||       :...|
Human   131 WDESTLELFLHELAIMDSNNF----LGNCGVGERE---GRVASALVARRHYRF-------IHGIG 181

  Fly   110 LAG--ALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVL-- 170
            .:|  :.|.....||:       :.:.|...::..|.||||.......|....:|    ||.|  
Human   182 RSGDISAVQPKAAGSS-------LLNKITNSLVLDIIKLAGVHTVANCFVVPMAT----GMSLTL 235

  Fly   171 -----------ARYKIAPEVKTSGMF------GMRPLVLFTSDESHYSFVKAANWLGLGSYNCVS 218
                       |:|.|.|.:.....|      |..|:|:             .|.|         
Human   236 CFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVI-------------ENVL--------- 278

  Fly   219 VRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAF-----DDINGAADVTERHGLWL 278
                 .|..|..||:|  .|||.:...|..:.|...||  ..|     |.:...|.:...:.:..
Human   279 -----EGDELRTDLKA--VEAKVQELGPDCILCIHSTT--SCFAPRVPDRLEELAVICANYDIPH 334

  Fly   279 HVDACLGGAALLSAKNRSLI---AGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTE 340
            .|:...|   :.|:|...||   |.:.|.::|..:..|....|:         .|.::...|.: 
Human   335 IVNNAYG---VQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPV---------GGAIIAGFNDS- 386

  Fly   341 AHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQ 405
              ::.:..|.|     .|..|  ....:|.....|.|.:.||.|   ::.....:...|..::::
Human   387 --FIQEISKMY-----PGRAS--ASPSLDVLITLLSLGSNGYKK---LLKERKEMFSYLSNQIKK 439

  Fly   406 RGDRF--RLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYT-------VAPKIKEQ----- 456
            ..:.:  ||:...|...::....  |.:....::...:..|.|:|       |.|....|     
Human   440 LSEAYNERLLHTPHNPISLAMTL--KTLDEHRDKAVTQLGSMLFTRQVSGARVVPLGSMQTVSGY 502

  Fly   457 -----MAHSGTLMIGY------SPLKAKNLGNFFRMVFTCFPIL---KSKELDFILDEIE 502
                 |:|:......|      ..:|.:::..|.:.:..|...:   :|||.|...|:.|
Human   503 TFRGFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYDKTE 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 88/464 (19%)
SEPSECSXP_016863766.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.