DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and ddc

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_012820057.1 Gene:ddc XenbaseID:XB-GENE-983285 Length:490 Species:Xenopus tropicalis

Alignment Length:454 Identity:117/455 (26%)
Similarity:185/455 (41%) Gaps:100/455 (22%)


  Fly     7 GAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETE 71
            |.:.||.:.|       .||.:                 :.:::.|.::|..|:.||.....| |
 Frog    10 GKDMVDYVAD-------YLEQI-----------------ESRQVFPDVEPGYLRPLIPDSAPE-E 49

  Fly    72 NCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFG----------LAGALVTEAMNGSTYTY 126
            ..:..||.:..::||...|  :|  :|:..|....|.|          |.||:.....:....|.
 Frog    50 GETYEEIIKDVERVIMPGV--TH--WHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWVCLTM 110

  Fly   127 EVAPVFSLIETEVIATICK--------LAGYK-EGDGIFAPGGSTSNMYGMVLARYKI-----AP 177
            ..:|..:.:||.::..:.|        |||.| ||.|:.....|.:.:..::.||.|:     |.
 Frog   111 ASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAE 175

  Fly   178 EVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNE---------RGQMLLDDLE 233
            ..|.:....:..:|.::||::|.|..:|    ||.|    .||..:         |||.|...||
 Frog   176 NPKLTEAEIVSRMVAYSSDQAHSSVERA----GLIS----GVRMKKIPSDENFVARGQALKKALE 232

  Fly   234 AKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLI 298
                |.||.|..|.|...|.|||...|||::.....|.....:|:|:||...|:|.:..:.|.|:
 Frog   233 ----EDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLM 293

  Fly   299 AGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNK--- 360
            .|:|.|:||::||||.:.....||.|..::...|:.         .|:.|..| :.||....   
 Frog   294 KGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIG---------AFKMDPVY-LQYDQQESGLV 348

  Fly   361 ------SVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIA---RLLEGKLRQRGDRFRLVIP 415
                  .:..||:..:.|.|.:.  |.||..||.|....|:.   ..||  ..::.|:|.:..|
 Frog   349 TDYRHWQIPLGRRFRSLKLWFVF--RIYGVKGLQVHIRKHVGLAHEFLE--CVKKDDQFEICAP 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 98/365 (27%)
ddcXP_012820057.1 Pyridoxal_deC 35..419 CDD:278699 110/406 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.