DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and csad

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_009295318.1 Gene:csad ZFINID:ZDB-GENE-041114-36 Length:544 Species:Danio rerio

Alignment Length:496 Identity:238/497 (48%)
Similarity:328/497 (66%) Gaps:20/497 (4%)


  Fly    19 MD--DWKI-LENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAEIEE 80
            ||  |.|: |...|:::.:|   .::..:..|:|:..:..||:|:.|::|::|:...|.    |:
Zfish    63 MDESDGKLFLTEAFNIIMEE---ILNKGRDLKEKVCEWKDPDQLRSLLDLELRDHGECH----EK 120

  Fly    81 LCQQ---VIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIAT 142
            |.|:   |..|||||.|.||.||||..:|...|.|.|:||.:|.|.|||||||||.|:|.|||:.
Zfish   121 LLQRVRDVAKYSVKTCHPRFFNQLFAGVDYHALTGRLITETLNTSQYTYEVAPVFVLMEEEVISK 185

  Fly   143 ICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAAN 207
            :..|.|:.||||||.||||.||||.:.:|||...|:|||.|::....:.:|||.:||||..|.|.
Zfish   186 LRSLVGWSEGDGIFCPGGSMSNMYAINVARYWAFPQVKTKGLWAAPRMAIFTSQQSHYSVKKGAA 250

  Fly   208 WLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTE 272
            :||:|:.|...|:.:|.|.|:.:||||||.:||::...|||||.||||||.||||.:...||:.|
Zfish   251 FLGIGTENVFIVQVDESGSMIPEDLEAKIVQAKSQDAVPFFVNATAGTTVQGAFDPLKRIADICE 315

  Fly   273 RHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCN 337
            |:|:|:||||..||:.|.|.|:|.|:||:|||||.:|||||.:...||||:.|.|::..||..|:
Zfish   316 RNGMWMHVDAAWGGSVLFSKKHRHLVAGIERANSVTWNPHKMLLTGLQCSVILFRDTTNLLMHCH 380

  Fly   338 STEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGK 402
            |.:|.||||||||||.|.|||:||:|||||:|..|.|||.||.|.......||.|..:.|.|..:
Zfish   381 SAKATYLFQQDKFYDTSLDTGDKSIQCGRKVDCLKLWLMWKAIGASGLSQRVDKAFALTRYLVEE 445

  Fly   403 LRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGY 467
            :.:| :.|:||. :..:.||||||||.:::  .:|.:|::..||..|||.|||:|...||:|:||
Zfish   446 MEKR-ENFQLVC-KGPFVNVCFWFIPPSLK--GKENSPDYQERLSKVAPVIKERMMKRGTMMVGY 506

  Fly   468 SPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            .|:...  .||||||... |.|.:|::||.|||:|:||:.:
Zfish   507 QPMDEH--VNFFRMVVVS-PQLTTKDMDFFLDEMEKLGKDL 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 209/407 (51%)
csadXP_009295318.1 DOPA_deC_like 140..540 CDD:99743 209/407 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45677
Phylome 1 0.910 0.690 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.