DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Sply

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_652032.1 Gene:Sply FlyBaseID:FBgn0010591 Length:545 Species:Drosophila melanogaster

Alignment Length:438 Identity:98/439 (22%)
Similarity:159/439 (36%) Gaps:112/439 (26%)


  Fly    22 WKIL---ENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVR-ETE----NCSLAEI 78
            |.::   ||::  :|.:..|.    |:.|:  :|.::.....||...|.. |||    |..|...
  Fly    44 WTVICQDENLY--IRGKRQFF----KFAKK--IPAVRRQVETELAKAKNDFETEIKKSNAHLTYS 100

  Fly    79 EELCQ---------QVIHYSVKTSH-----GRFHNQLFGQLDPFGLAGALVTEAMNGSTYT---- 125
            |.|.:         :::...:||.|     ||....::|.....   ..||||....::||    
  Fly   101 ETLPEKGLSKEEILRLVDEHLKTGHYNWRDGRVSGAVYGYKPDL---VELVTEVYGKASYTNPLH 162

  Fly   126 YEVAPVFSLIETEVIATICKL-AGYKEGDGIFAPGGSTSNMYGMVLARYK-IAPEVKTSGMFGMR 188
            .::.|....:|.||:...|.| .|.....|....||:.|.:  |.:..|: .|.|.|  |:  .|
  Fly   163 ADLFPGVCKMEAEVVRMACNLFHGNSASCGTMTTGGTESIV--MAMKAYRDFAREYK--GI--TR 221

  Fly   189 PLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTA 253
            |.:: .....|.:|.|.      |.|..:.||:        .|::.:..|...:.    |.....
  Fly   222 PNIV-VPKTVHAAFDKG------GQYFNIHVRS--------VDVDPETYEVDIKK----FKRAIN 267

  Fly   254 GTTVL----------GAFDDINGAADVTERHGLWLHVDACLGGAALLSAKN-----RSLIAGLER 303
            ..|:|          |..|||...|.:..::.:.:|||||||...:...:|     |.....::.
  Fly   268 RNTILLVGSAPNFPYGTIDDIEAIAALGVKYDIPVHVDACLGSFVVALVRNAGYKLRPFDFEVKG 332

  Fly   304 ANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDT---------GN 359
            ..|.|.:.||...||...|:.                   |:...|:.|..:..         |:
  Fly   333 VTSISADTHKYGFAPKGSSVI-------------------LYSDKKYKDHQFTVTTDWPGGVYGS 378

  Fly   360 KSV---QCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLR 404
            .:|   :.|..|.|  .|..:.:.||..|.......:..||.:|..:|
  Fly   379 PTVNGSRAGGIIAA--CWATMMSFGYDGYLEATKRIVDTARYIERGVR 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 75/342 (22%)
SplyNP_652032.1 DOPA_deC_like 132..494 CDD:99743 76/343 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.