DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and sepsecs

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001004947.2 Gene:sepsecs XenbaseID:XB-GENE-962222 Length:506 Species:Xenopus tropicalis

Alignment Length:526 Identity:105/527 (20%)
Similarity:177/527 (34%) Gaps:166/527 (31%)


  Fly    43 QKWDKQKIVPFLQPDKLKELINLKVRETE----NCSLAEIEELCQQVIHYSVKTSHG---RFHNQ 100
            :.||:..|..||.        .|.|.::.    ||.:.|.|.          :.:.|   |.|.:
 Frog    44 EPWDESTIEIFLN--------ELAVMDSNNFLGNCGVGEREG----------RVASGMVSRRHYR 90

  Fly   101 LFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNM 165
            |...:...|...|:..:|...|        |.:.:...::..|.:|||.:.....|....:|   
 Frog    91 LIHGIGRSGDISAIQPKAAGSS--------VLNKLTNSMVLDIIRLAGVRTASSCFVVPMAT--- 144

  Fly   166 YGMVL-------------ARYKIAPEVKTSGMF------GMRPLVL---FTSDESHYSFVKAANW 208
             ||.|             |:|.|.|.:.....|      |..|:|:   ...||           
 Frog   145 -GMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDE----------- 197

  Fly   209 LGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAF-----DDINGAA 268
                      :||:      ||.:||||.|..|..     :.|...||  ..|     |.:...|
 Frog   198 ----------LRTD------LDAVEAKITELGAEN-----ILCVHSTT--SCFAPRVPDRVEELA 239

  Fly   269 DVTERHGLWLHVDACLGGAALLSAKNRSLI---AGLERANSFSWNPHKTIGAPLQCSLFLTRESG 330
            .:.:::.:...|:...|   :.|:|...||   |.:.|.::|..:..|....|:         .|
 Frog   240 VICKKYEIPHVVNNAYG---VQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPV---------GG 292

  Fly   331 RLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHA--- 392
            .::...:.:   ::.:..|.|     .|..|  ....:|.....|.|.|.||.|  |:.:..   
 Frog   293 AVIAGFSDS---FVQEISKMY-----PGRAS--ASPSLDVLITLLSLGASGYNK--LLKERKEMF 345

  Fly   393 IHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEE-----TPEWWSRLYT---- 448
            ::::..|:...::..:|. |..|.:.        |..|:.::|..|     ..:..|.|:|    
 Frog   346 VYLSSELKKLAKELNERL-LETPHNP--------ISLALSLTSLSEQSGSAVTQLGSMLFTRQVS 401

  Fly   449 ---VAP----------KIKEQMAHSGTLMIGYSP------LKAKNLGNFFRMVFTCFPILKSKEL 494
               |.|          ..|..|:||......|..      :|.:::..|.:.:..|..:.| ||.
 Frog   402 GARVVPLGTSQTINGYVFKGFMSHSNNYPCAYLNAASAICIKKQDVDMFIKRLDKCLRLCK-KEK 465

  Fly   495 DFILDE 500
            ....||
 Frog   466 HLAKDE 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 92/466 (20%)
sepsecsNP_001004947.2 Tetramerization. {ECO:0000250|UniProtKB:Q9HD40} 1..44 105/527 (20%)
selenium_SpcS 12..458 CDD:211833 100/511 (20%)
Phosphate loop (P-loop). {ECO:0000250|UniProtKB:Q9HD40} 96..106 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.