DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and CG1427

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_649556.3 Gene:CG1427 FlyBaseID:FBgn0037347 Length:478 Species:Drosophila melanogaster

Alignment Length:360 Identity:67/361 (19%)
Similarity:126/361 (35%) Gaps:121/361 (34%)


  Fly    50 IVPFLQPDKLK-ELINLKV---RE---------------TENC-------SLAEIEELCQQ-VIH 87
            :||.:.|..:| |.:|..|   ||               |.:|       .:||:.:|.:| .|.
  Fly   184 LVPVVIPCLIKGESLNTNVDLFREKIKSLGVDSILCLYTTTSCFAPRNSDDIAEVSKLSKQWQIP 248

  Fly    88 YSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEG 152
            :.|..::|....::..||:.....|.:  :....|:....:.||.|.|          :|.:.|.
  Fly   249 HLVNNAYGLQAKEIVNQLECANRVGRI--DYFVQSSDKNLLVPVGSAI----------VASFNES 301

  Fly   153 -----DGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLG 212
                 ...:|...|.|....:::....:       |..|.|  :||.....::::::.       
  Fly   302 VLHDVASTYAGRASGSQSLDVLMTLLSL-------GRNGFR--LLFDQRGENFNYLRE------- 350

  Fly   213 SYNCVSVR--TNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHG 275
                 ::|  ...||::::|.....|:.|           .|..|.   |.|.:.....:    |
  Fly   351 -----NLRKFAEPRGEIVIDSRFNSISLA-----------ITLATL---AGDQMKSITKL----G 392

  Fly   276 LWLHVDACLGGAALLSAKNRS------LIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLE 334
            ..||:....|...::..:|::      |..|..|:|  ...|:.|:.|    .:.:|||      
  Fly   393 SMLHMRGVSGARVIVPGQNKTIDGHEFLDFGSHRSN--LQVPYLTVAA----GIGITRE------ 445

  Fly   335 RCNSTEAHYLFQQDKFYDV-------SYDTGNKSV 362
                       :.|||:|:       .:.|.|:.:
  Fly   446 -----------EIDKFFDIFNKCWNQIFQTKNEKI 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 49/287 (17%)
CG1427NP_649556.3 AAT_I 12..457 CDD:302748 65/347 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.