DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and ddc

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_998507.1 Gene:ddc ZFINID:ZDB-GENE-040426-2656 Length:480 Species:Danio rerio

Alignment Length:508 Identity:114/509 (22%)
Similarity:203/509 (40%) Gaps:92/509 (18%)


  Fly     7 GAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETE 71
            |.|.||.:.|       .:||:                 :|:::.|.::|..|:.||..:..| |
Zfish    10 GREMVDYVAD-------YIENI-----------------EKRQVYPDVEPGYLRSLIPEEAPE-E 49

  Fly    72 NCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGST----YTYEVAPVF 132
            ..|..::.:..::||...|...|..:....|.....:   .|::.:.:.|:.    :::..:|..
Zfish    50 PESYEDVVKDIERVIMPGVTHWHSPYFYAYFPTAHSY---PAMLADILCGAIGCIGFSWAASPAC 111

  Fly   133 SLIETEVIATICK--------LAGYK-EGDGIFAPGGSTSNMYGMVLARYKIA-------PEVKT 181
            :.:||.::..:.|        |||.| :|.|:.....|.:.:..::.||.||.       |:...
Zfish   112 TELETVMLDWLGKMLKLPEDFLAGTKGKGGGVIQSTASEATLITLLAARSKIVRLIQADHPDRSE 176

  Fly   182 SGMFGMRPLVLFTSDESHYSFVKAANWLGL-GSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGE 245
            :.:  :..||.::||::|.|..:|    || |......:.|:.:..:..|.||..:.|.||.|..
Zfish   177 TDI--ISKLVAYSSDQAHSSVERA----GLIGGVRMKKIPTDSKFSVRGDALERILKEDKAAGLI 235

  Fly   246 PFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWN 310
            |||...|.|||...|||.|.....:.....:|:|:||...|:|.:..:.|.|:.|:|.|:||::|
Zfish   236 PFFFCATLGTTASCAFDCITELGPICNAEKMWMHIDAAYAGSAFICPEFRPLLNGIEFADSFNFN 300

  Fly   311 PHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWL 375
            |||.:.....||....::...:: .....|..||....:...:..|..:..:..||:..:.|.|.
Zfish   301 PHKWLLINFDCSAMWVKKRADII-GAFKMEPLYLKHDHQESGLVTDYRHWQIPLGRRFRSLKMWF 364

  Fly   376 MLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDR--------------FRLVIPEHEYSNVC--- 423
            :.  |.||...|......|:....|.:...|.|:              |||..|.....|:.   
Zfish   365 VF--RMYGLKALQAYIRKHVGLAKEFEAFVRADQRFEISADVVMGLVCFRLKGPNELSENLLKRI 427

  Fly   424 -----FWFIP------------KAMRVSSEEETPEWWSRLYTVAPKIKEQMAH 459
                 ...:|            ...|.:......|.|..:..:|.::.:::.|
Zfish   428 NSARKIHLVPCHLAGLFVLRFAVCARATESRHVQEAWCHIRQLASELLQELLH 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 94/419 (22%)
ddcNP_998507.1 AAT_I 1..478 CDD:302748 113/505 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.