DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and sepsecs

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_956448.1 Gene:sepsecs ZFINID:ZDB-GENE-040426-859 Length:490 Species:Danio rerio

Alignment Length:591 Identity:118/592 (20%)
Similarity:180/592 (30%) Gaps:241/592 (41%)


  Fly     3 ESVDGAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKV 67
            :.:|.....:|:...|:|..|..|                :.|.:..|..||.        .|.|
Zfish    20 QGLDARRGHEQLIRRLLDQGKCPE----------------EGWSESTIELFLN--------ELAV 60

  Fly    68 RETE----NCSLAEIE-ELCQQVI---HYSVKTSHGRFHNQLFGQLDPFGLAG--ALVTEAMNGS 122
            .::.    ||.:.|.| .:...::   ||  :..||            .|.:|  |.|.....||
Zfish    61 MDSNNFLGNCGVGEREGRVASSLVARRHY--RLIHG------------IGRSGDIAAVQPKAAGS 111

  Fly   123 TYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVL-------------ARYK 174
            :       :.:.|...|:..:.||.|.:.....|....:|    ||.|             |||.
Zfish   112 S-------LLNKITNSVVLDVLKLTGVRSVSSCFVVPMAT----GMSLTLCFLTLRHRRPKARYI 165

  Fly   175 IAPEVKTSGMF------GMRPLVL---FTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLD 230
            :.|.:.....|      |..|:|:   ...||                     :|||      |:
Zfish   166 LWPRIDQKSCFKSMVTAGFEPVVIENVLEGDE---------------------LRTN------LE 203

  Fly   231 DLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNR 295
            ::|.||.|..|..     ..|...||  ..|     |..|.:|          |...::|.||:.
Zfish   204 EVERKIEEFGAEN-----TLCVHSTT--SCF-----APRVPDR----------LEELSVLCAKHD 246

  Fly   296 SLIAGLERANSFSWNPHKTIGA----PLQCSLFLTRES--GRLLERCNSTEAHYL---------- 344
            .              ||....|    |.:|...:.:.:  ||:.....|.:.:::          
Zfish   247 I--------------PHIVNNAYGVQPSKCMHLIQQGARVGRIDAFVQSLDKNFVVPVGGAIIAG 297

  Fly   345 FQQDKFYDVSYDTGNKSVQCGR-----KIDAFKFWLMLKARGYGK--------YGLMVDHAIHIA 396
            |.::...::|      .:..||     .:|.....|.|.|.||.|        ||       |:|
Zfish   298 FDENFIQEIS------KIYPGRASASPSLDVLITLLTLGANGYKKLLADRKELYG-------HLA 349

  Fly   397 RLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVS-----SEEETPEWWSRLYT-------V 449
            :.|.....:.|:|. |..|.:.        |..||.::     |.....:..|.|:|       |
Zfish   350 QELSALAARHGERL-LKTPHNP--------ISLAMSLNHLEAHSSSAVTQLGSMLFTRQVSGARV 405

  Fly   450 APKIKEQ----------MAHSGTLMIGYSPLKA---------------KNLGNFFRMVFTCFPIL 489
            .|...:|          |:||......|  |.|               |.||.       |..||
Zfish   406 VPLGVQQTVSGHTFSGFMSHSEAYPCPY--LNAASAIGITKGDVTVCMKRLGK-------CLKIL 461

  Fly   490 KSKELD 495
            |.::.|
Zfish   462 KKEKSD 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 98/490 (20%)
sepsecsNP_956448.1 Tetramerization. {ECO:0000250|UniProtKB:Q9HD40} 1..44 6/40 (15%)
selenium_SpcS 12..458 CDD:211833 114/581 (20%)
Phosphate loop (P-loop). {ECO:0000250|UniProtKB:Q9HD40} 96..106 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.