DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Gad1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001261396.1 Gene:Gad1 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster

Alignment Length:463 Identity:198/464 (43%)
Similarity:280/464 (60%) Gaps:10/464 (2%)


  Fly    48 QKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAG 112
            :|::.|..|:.:|.|::|.|.: ....|.::.|.|...:.|.|||.|..|.|||...||...:||
  Fly    56 EKVLDFHHPEDMKRLLDLDVPD-RALPLQQLIEDCATTLKYQVKTGHPHFFNQLSNGLDLISMAG 119

  Fly   113 ALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAP 177
            ..:|...|.:.:|||:||||.|:|..|:..:.::.|:..||.|.|||||.||:|..:.||:|:.|
  Fly   120 EWLTATANTNMFTYEIAPVFILMENVVLTKMREIIGWSGGDSILAPGGSISNLYAFLAARHKMFP 184

  Fly   178 EVKTSGMFGM-RPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKA 241
            ..|..|..|: ..||:||||:.|||....|...|||:.:|:.|.::|.|:|:..:||..|.|.||
  Fly   185 NYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDEHGKMITSELERLILERKA 249

  Fly   242 RGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNR-SLIAGLERAN 305
            :|..|||||.||||||||||||||..||:.:::..|:|:||..||..|:|.|:| ....|:|||:
  Fly   250 KGDIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSRKHRHPRFTGVERAD 314

  Fly   306 SFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDA 370
            |.:|||||.:||.||||....:|.| ||..||...|.|||..||.||:|||||:|.:||||..|.
  Fly   315 SVTWNPHKLMGALLQCSTIHFKEDG-LLISCNQMSAEYLFMTDKQYDISYDTGDKVIQCGRHNDI 378

  Fly   371 FKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSS 435
            ||.||..:|:|...:....|..:.:.:....::|::.|||.|:: |.|..||.||::||.:|...
  Fly   379 FKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQSDRFHLIL-EPECVNVSFWYVPKRLRGVP 442

  Fly   436 EEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDE 500
            .:...|  ..|..:.|.||.:|...||||:||.|...:  .||||.:.:...: ...::||:|||
  Fly   443 HDAKKE--VELGKICPIIKGRMMQKGTLMVGYQPDDRR--PNFFRSIISSAAV-NEADVDFMLDE 502

  Fly   501 IERLGEKI 508
            |.|||:.:
  Fly   503 IHRLGDDL 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 181/409 (44%)
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:278699 167/373 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45677
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.