DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and gad1b

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_919400.1 Gene:gad1b ZFINID:ZDB-GENE-030909-3 Length:587 Species:Danio rerio

Alignment Length:496 Identity:228/497 (46%)
Similarity:319/497 (64%) Gaps:30/497 (6%)


  Fly    23 KILENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKL---KELINLKVRETENCSLAEIEELCQ 83
            :::|.:.:.:||  ||       |:. |::.|..|.:|   .|..||::.:... ||.:|...|:
Zfish   112 EVVEILTNYVRK--TF-------DRSTKVLDFHHPHQLLEGMEGFNLELSDQPE-SLEQILVDCR 166

  Fly    84 QVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAG 148
            ..:.|.|:|.|.||.|||...||..||||..:|...|.:.:|||:||||.|:|...:..:.::.|
Zfish   167 DTLKYGVRTGHPRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIIG 231

  Fly   149 YKEGDG--IFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGL 211
            :..|||  :|:|||:.||||.:::||||..|||||.||.....||||||:.||||..||...||.
Zfish   232 WPNGDGDALFSPGGAISNMYSVMVARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAVLGF 296

  Fly   212 GSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGL 276
            |..|.:.::|:|||:::..|||||:.:||.:|..|.|||.||||||.||||.||..||:.|::.|
Zfish   297 GKENVILLKTDERGRVIPADLEAKVIDAKQKGYVPLFVNATAGTTVYGAFDPINDIADICEKYNL 361

  Fly   277 WLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEA 341
            |||||...||..|:|.|:|..::|:|||||.:|||||.:|.|||||..|.||.| :|:.|||..|
Zfish   362 WLHVDGAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKG-ILQGCNSMCA 425

  Fly   342 HYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQR 406
            .||||.||.|||:||||:|::||||.:|.||||||.||:|...:...:|..:.::..|..|::.|
Zfish   426 GYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDRCLELSEYLYNKIKNR 490

  Fly   407 GDRFRLVI---PEHEYSNVCFWFIPKAMR-VSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGY 467
             :.:.:|.   |:|  :|||||:||.::| :.:.:|..|   :|:.||||||..|...||.|:||
Zfish   491 -EGYEMVFEGQPQH--TNVCFWYIPPSLRGMPNGDERRE---KLHRVAPKIKAMMMECGTTMVGY 549

  Fly   468 SPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            .|...|  .||||||.:...:.|| ::||::|||||||:.:
Zfish   550 QPQGDK--VNFFRMVVSNHAVTKS-DIDFLIDEIERLGQDL 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 204/413 (49%)
gad1bNP_919400.1 Pyridoxal_deC 137..511 CDD:278699 183/379 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.