DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Gadl1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_001076997.1 Gene:Gadl1 RGDID:1565145 Length:600 Species:Rattus norvegicus

Alignment Length:513 Identity:240/514 (47%)
Similarity:337/514 (66%) Gaps:36/514 (7%)


  Fly     5 VDGAETVDQIRDGLMDDWK------------ILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPD 57
            |||.     :.:|...|.|            |:|.|  :|:..|.         .:|:..:..|:
  Rat   109 VDGV-----VLNGPQTDVKAGEKFVEEACRLIMEEV--VLKATDI---------NEKVCEWQPPE 157

  Fly    58 KLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGS 122
            :|::|::|::|:|.. |..::.:|||.||.|||||:|.||.|||:..||...||..::|||:|.|
  Rat   158 QLRQLLDLEMRDTGE-SQDKLLKLCQDVIRYSVKTNHPRFFNQLYAGLDYHSLAARIITEALNPS 221

  Fly   123 TYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGM 187
            .|||||:|||.|:|..|:..:.:..|:|||||||.||||.|||..|.||||:..|::|..|:.|:
  Rat   222 IYTYEVSPVFLLVEEAVLKKMIECVGWKEGDGIFNPGGSVSNMCAMNLARYRHCPDIKDKGLSGL 286

  Fly   188 RPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCT 252
            ..|:||||.|.|||..|||::||:|:.|...|.|:.||:|:.::||.:|.:.|..|..||.|..|
  Rat   287 PRLILFTSAECHYSMKKAASFLGIGTQNVYFVETDGRGKMIPEELEKQIWQGKQEGAVPFLVCAT 351

  Fly   253 AGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGA 317
            :|||||||||.::..|:|.|||||||||||..||:||:|.|:|.|:.|:.||:|.:|||||.:.|
  Rat   352 SGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSALVSRKHRRLLHGIHRADSVAWNPHKMLMA 416

  Fly   318 PLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGY 382
            .:|||..|.::...||::|.|.:|.||||||||||||||||:||:||.|:.||||||:..||.|.
  Rat   417 GIQCSALLVKDKSDLLKKCYSAKATYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKAVGT 481

  Fly   383 GKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLY 447
            ......|:.|..::|.|..::::| :.|:|:| |.||:|||||:||.::|..:  |.||:|.:|.
  Rat   482 SGLEERVNRAFALSRYLVDEIKKR-EGFKLLI-EPEYTNVCFWYIPPSLREMA--EGPEFWRKLS 542

  Fly   448 TVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLG 505
            .|||.|||:|...|:||:||.|.:.|  .||||.| ...|.:..:::||:||||:.||
  Rat   543 LVAPAIKEKMMKKGSLMLGYQPHRGK--VNFFRQV-VISPQVSREDMDFLLDEIDSLG 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 207/407 (51%)
Gadl1XP_001076997.1 DOPA_deC_like 196..596 CDD:99743 207/407 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.