DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Hdc

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001260855.1 Gene:Hdc FlyBaseID:FBgn0005619 Length:847 Species:Drosophila melanogaster

Alignment Length:583 Identity:130/584 (22%)
Similarity:221/584 (38%) Gaps:177/584 (30%)


  Fly     7 GAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETE 71
            |.|.||.|.|       .|||:                 .::::.|.:.|..:::|:      .|
  Fly    10 GKEMVDYIAD-------YLENI-----------------RERRVFPDVSPGYMRQLL------PE 44

  Fly    72 NCSL---------AEIEELCQQ-VIHYSVKTSHGRFH--NQLFGQLDPFGLAGALVTEAMNGSTY 124
            :..:         :::|.:... :.|:.....|..|.  |.:     | .|.|.::.:|:|...:
  Fly    45 SAPIEGEPWPKIFSDVERIVMPGITHWQSPHMHAYFPALNSM-----P-SLLGDMLADAINCLGF 103

  Fly   125 TYEVAPVFSLIETEVIATICKLAG----------YKEGDGIFAPGGSTSNMYGMVLAR------- 172
            |:..:|..:.:|..|:..:.|:.|          ..:|.|:.....|.:.:..::..|       
  Fly   104 TWASSPACTELEIIVMNWLGKMIGLPDAFLHLSSQSQGGGVLQTTASEATLVCLLAGRTRAIQRF 168

  Fly   173 ------YKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNE-------R 224
                  |:.| |:...       ||.:.||::|.|..||| .:||     |.:|..|       |
  Fly   169 HERHPGYQDA-EINAR-------LVAYCSDQAHSSVEKAA-LIGL-----VRMRYIEADDDLAMR 219

  Fly   225 GQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAAL 289
            |::|.:.:|..|.:    |..||:|..|.|||...:||::.....|...|.|||||||...|:|.
  Fly   220 GKLLREAIEDDIKQ----GLVPFWVCATLGTTGSCSFDNLEEIGIVCAEHHLWLHVDAAYAGSAF 280

  Fly   290 LSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFY--- 351
            :..:.|:.:.|:|||:|.::||.|.:......:....|:         ||..|..|..:..|   
  Fly   281 ICPEFRTWLRGIERADSIAFNPSKWLMVHFDATALWVRD---------STAVHRTFNVEPLYLQH 336

  Fly   352 ---DVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLM--VDHAIHIARLLEGKL-------- 403
               .|:.|..:..:...|:..|.|.|.:|  |.||..||.  :...:.:|:..|..:        
  Fly   337 ENSGVAVDFMHWQIPLSRRFRALKVWFVL--RSYGIKGLQRHIREGVRLAQKFEALVLADHRFEL 399

  Fly   404 -----------RQRGDR-------FRLVIPEHEYSNVCFWFIPKAMR--------VSSEEET--- 439
                       |.|||.       .||   .|..:..|   ||.:::        ::|...|   
  Fly   400 PAKRHLGLVVFRIRGDNEITEKLLKRL---NHRGNLHC---IPSSLKGQYVIRFTITSTHTTLDD 458

  Fly   440 -PEWWSRLYTVAPKIKEQM------------------AHSGTLMIGYSPLKAKNLGNFFRMVF 483
             .:.|..:..||..:.|:|                  |...:|::..|||..|.:...|..:|
  Fly   459 IVKDWMEIRQVASTVLEEMNITISNRVYLKETKEKNEAFGSSLLLSNSPLSPKVVNGSFAAIF 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 114/484 (24%)
HdcNP_001260855.1 Pyridoxal_deC 35..413 CDD:278699 96/419 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.