DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Tdc1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_610226.2 Gene:Tdc1 FlyBaseID:FBgn0259977 Length:587 Species:Drosophila melanogaster

Alignment Length:505 Identity:128/506 (25%)
Similarity:211/506 (42%) Gaps:61/506 (12%)


  Fly    29 FHLLRKE--DTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVK 91
            |....||  |..|......:::.:.|.|.|..||:|:.....::.......:|:..|:::...|.
  Fly     6 FRKYGKEVIDYICQYGTNIEERDVAPTLDPGYLKKLLPADAPQSPEPFKDVLEDFEQKIMPGVVH 70

  Fly    92 TSHGRFHNQLFGQLDPF-GLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEGDGI 155
            .:|.:|. ..|...:.| .:.|.:::.|:....:::...|..:.:||.|:....|..|..:....
  Fly    71 WNHPKFF-AYFPSGNSFPSVLGDMLSSAIGSIGFSWASCPAAAELETIVMNWYAKALGLPKAFVS 134

  Fly   156 FAPG--------GSTSN--MYGMVLARYKIAPEVK--TS---GMFGMRPLVLFTSDESHYSFVKA 205
            .|||        ||.|.  :..::.||.:...|:|  ||   .:| :..|:.:.|.|:|.|..||
  Fly   135 DAPGSTGGGALQGSASECVLVSLITARARAISELKGQTSVHDSVF-LPSLIAYASREAHSSVEKA 198

  Fly   206 ANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADV 270
            .. :.|.....:.  .:|.|:|.:|.|...|......|..||||..|.|||...|||||.....|
  Fly   199 TK-MALVKLRIID--ADEHGRMRVDLLRQAIQNDVNAGLTPFFVVATVGTTGGCAFDDITEIGKV 260

  Fly   271 TER-HGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLE 334
            ..: ..:|||||....|.:.:..:.|...||||.|:||:.||:|.:......|....|:...|..
  Fly   261 CRQVSSIWLHVDGAYAGNSFILPEMRVFSAGLEYADSFNTNPNKLLLTNFDASALWVRDVMNLKS 325

  Fly   335 RCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLM--VDHAIHIAR 397
            ..|....:  .:.:....|.|  .:..:...|:..|.|.|.:.  |.||..||.  :.:.:.:|:
  Fly   326 ALNVNPLY--LRHEHLTGVDY--RHYGIPLSRRFRALKLWFVF--RTYGIRGLQEYIRNHMALAK 384

  Fly   398 LLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGT 462
            ..| .|.::.:||.:....| ...|||     .||...|..            ..:..|:.|||.
  Fly   385 KFE-MLVRKDERFEVRNDVH-LGLVCF-----RMRTGDEPN------------HMLLAQINHSGK 430

  Fly   463 LMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILD---EIERLGEKIV 509
            :.:  :|  ||..|.:  ::..|.....:.|.| ||:   :|:...|:|:
  Fly   431 MHM--TP--AKFNGRY--VIRFCVTYEHATEKD-ILEAWTQIKCFAEEIL 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 111/429 (26%)
Tdc1NP_610226.2 Pyridoxal_deC 35..412 CDD:278699 103/395 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.