DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Ddc

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_724163.1 Gene:Ddc FlyBaseID:FBgn0000422 Length:510 Species:Drosophila melanogaster

Alignment Length:495 Identity:124/496 (25%)
Similarity:207/496 (42%) Gaps:82/496 (17%)


  Fly    47 KQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHG-RFHNQLFGQLDPFGL 110
            :::::|.::|..||.||.....|... ...::.:..::||...|...|. :|| ..|...:.:  
  Fly    61 ERRVLPEVKPGYLKPLIPDAAPEKPE-KWQDVMQDIERVIMPGVTHWHSPKFH-AYFPTANSY-- 121

  Fly   111 AGALVTEAMNGST----YTYEVAPVFSLIET----------EVIATICKLAGYKEGDGIFAPGGS 161
             .|:|.:.::|:.    :|:..:|..:.:|.          |:.|.....:|.| |.|:.....|
  Fly   122 -PAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGK-GGGVIQGTAS 184

  Fly   162 TSNMYGMVLARYKIAPEVKTSGMFGMRP----------LVLFTSDESHYSFVKAANWLGLGSYNC 216
            .|.:..::.|:.|...|||.     :.|          ||.:.||::|.|..:|..   ||....
  Fly   185 ESTLVALLGAKAKKLKEVKE-----LHPEWDEHTILGKLVGYCSDQAHSSVERAGL---LGGVKL 241

  Fly   217 VSVRTNE---RGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWL 278
            .||::..   ||..|...:|..:||    |..||:...|.|||...|||.::....|..:|.||:
  Fly   242 RSVQSENHRMRGAALEKAIEQDVAE----GLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWI 302

  Fly   279 HVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHY 343
            ||||...|:|.:..:.|.|:.|:|.|:||::||||.:.....||....::...::   |:.....
  Fly   303 HVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVV---NAFNVDP 364

  Fly   344 LFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLE-----GKL 403
            |:.:......:.|..:..:..||:..|.|.|.:|  |.||...|..    ||.|...     |.|
  Fly   365 LYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVL--RLYGVENLQA----HIRRHCNFAKQFGDL 423

  Fly   404 RQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYS 468
            .....||.|. .|.....|||       |:....|..|      .:..:|      :|...|...
  Fly   424 CVADSRFELA-AEINMGLVCF-------RLKGSNERNE------ALLKRI------NGRGHIHLV 468

  Fly   469 PLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            |.|.|:: .|.||.. |....:|:::::...|:....:::
  Fly   469 PAKIKDV-YFLRMAI-CSRFTQSEDMEYSWKEVSAAADEM 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 113/439 (26%)
DdcNP_724163.1 Pyridoxal_deC 70..446 CDD:278699 109/411 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.