| Sequence 1: | NP_649211.1 | Gene: | CG5618 / 40241 | FlyBaseID: | FBgn0036975 | Length: | 510 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_724163.1 | Gene: | Ddc / 35190 | FlyBaseID: | FBgn0000422 | Length: | 510 | Species: | Drosophila melanogaster |
| Alignment Length: | 495 | Identity: | 124/495 - (25%) |
|---|---|---|---|
| Similarity: | 207/495 - (41%) | Gaps: | 82/495 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 47 KQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHG-RFHNQLFGQLDPFGL 110
Fly 111 AGALVTEAMNGST----YTYEVAPVFSLIET----------EVIATICKLAGYKEGDGIFAPGGS 161
Fly 162 TSNMYGMVLARYKIAPEVKTSGMFGMRP----------LVLFTSDESHYSFVKAANWLGLGSYNC 216
Fly 217 VSVRTNE---RGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWL 278
Fly 279 HVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHY 343
Fly 344 LFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLE-----GKL 403
Fly 404 RQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYS 468
Fly 469 PLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5618 | NP_649211.1 | AAT_I | 97..504 | CDD:302748 | 113/438 (26%) |
| Ddc | NP_724163.1 | Pyridoxal_deC | 70..446 | CDD:278699 | 109/410 (27%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0076 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||