DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and amd

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_476592.1 Gene:amd FlyBaseID:FBgn0000075 Length:510 Species:Drosophila melanogaster

Alignment Length:528 Identity:128/529 (24%)
Similarity:208/529 (39%) Gaps:101/529 (19%)


  Fly     7 GAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETE 71
            |...:|.|.|       .|||:    |.:|             ::|.::|..|.:|:..::.|..
  Fly    10 GKAAIDYIAD-------YLENI----RDDD-------------VLPNVEPGYLLDLLPTEMPEEP 50

  Fly    72 NC---SLAEIEELCQQ-VIHYSVKTSHGRF-----HNQLFGQL--DPFGLAGALVTEAMNGSTYT 125
            ..   .|.:|..:.:. :.|:.....|..:     :..:.|::  ..||:.|           ::
  Fly    51 EAWKDVLGDISRVIKPGLTHWQSPHMHAYYPTSTSYPSIVGEMLASGFGVIG-----------FS 104

  Fly   126 YEVAPVFSLIETEV---IATICKLAGYKE------GDGIFAPGGSTSNMYGMVLARYKIA----- 176
            :..:|..:.:|..|   :|...||..:.:      |.|:.....|.:.:..::.||.:..     
  Fly   105 WICSPACTELEVVVMDWLAKFLKLPAHFQHASDGPGGGVIQGSASEAVLVAVLAAREQAVANYRE 169

  Fly   177 --PEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLL---DDLEAKI 236
              ||:..|.:.|.  ||.::||:|:....||      |....:.:|....|:..:   |.|...|
  Fly   170 SHPELSESEVRGR--LVAYSSDQSNSCIEKA------GVLAAMPIRLLPAGEDFVLRGDTLRGAI 226

  Fly   237 AEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGL 301
            .|..|.|..|.....|.|||...|:|||...:.|.|...:||||||...|.|....:...|..||
  Fly   227 EEDVAAGRIPVICVATLGTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAGGAFALEECSDLRKGL 291

  Fly   302 ERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGR 366
            :|.:|.::|.||.:.....||....|::.::::..| .:..||..:.:......|..:..:..||
  Fly   292 DRVDSLNFNLHKFMLVNFDCSAMWLRDANKVVDSFN-VDRIYLKHKHEGQSQIPDFRHWQIPLGR 355

  Fly   367 KIDAFKFWLMLKARGYGKYGLM--VDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPK 429
            :..|.|.|:..  |..|..||.  |...|.:|:..| :|..:..||.||.| .....||  |.||
  Fly   356 RFRALKVWITF--RTLGAEGLRNHVRKHIELAKQFE-QLVLKDSRFELVAP-RALGLVC--FRPK 414

  Fly   430 AMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKEL 494
                ...|.|.:...||          |......|:     ||::.|..|.....|....|:.::
  Fly   415 ----GDNEITTQLLQRL----------MDRKKIYMV-----KAEHAGRQFLRFVVCGMDTKASDI 460

  Fly   495 DFILDEIE 502
            ||...|||
  Fly   461 DFAWQEIE 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 110/435 (25%)
amdNP_476592.1 Pyridoxal_deC 35..414 CDD:278699 100/405 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.