DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and b

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001246025.1 Gene:b FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster

Alignment Length:465 Identity:207/466 (44%)
Similarity:308/466 (66%) Gaps:15/466 (3%)


  Fly    49 KIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGA 113
            |:|.:.:|.:|::|.:.::|| :..|..::.||.::.|.:||||.|..|.|||:..:||:.|.|.
  Fly   121 KVVEWHEPAELRQLFDFQLRE-QGESQDKLRELLRETIRFSVKTGHPYFINQLYSGVDPYALVGQ 184

  Fly   114 LVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYK---EGDGIFAPGGSTSNMYGMVLARYKI 175
            .:|:|:|.|.|||||||:|:|:|.:|:|.:.::.|:.   :|||||.||||.:|.|.:..|||:.
  Fly   185 WLTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNGGQGDGIFCPGGSIANGYAISCARYRH 249

  Fly   176 APEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAK 240
            :||.|.:|:|..:||::|||:::|||..|.|.::|.||.:...:.|||.|:|.|.|||.::....
  Fly   250 SPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFGSDHVRKIATNEVGKMRLSDLEKQVKLCL 314

  Fly   241 ARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERAN 305
            ..|.:|..|:.||||||||||||:.|.::|.:::.:|:||||..||.||:|.|.|.|:.|:|||:
  Fly   315 ENGWQPLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAAWGGGALMSKKYRHLLNGIERAD 379

  Fly   306 SFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDA 370
            |.:|||||.:.|..|||.||||.. ::|.:|:||.|.||||:|||||.|:|||:|.:||||:.|.
  Fly   380 SVTWNPHKLLAASQQCSTFLTRHQ-QVLAQCHSTNATYLFQKDKFYDTSFDTGDKHIQCGRRADV 443

  Fly   371 FKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSS 435
            ||||.|.||:|.......|:....:|.....|:|:| ..|.||:...|.:|:.||::|..:|  .
  Fly   444 FKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRER-PGFELVLESPECTNISFWYVPPGLR--E 505

  Fly   436 EEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVF--TCFPILKSKELDFIL 498
            .|...|::.||:.||||:||.|...|::||.|.||  :.|.||||:|.  :|   |:..::.:.|
  Fly   506 MERNREFYDRLHKVAPKVKEGMIKKGSMMITYQPL--RQLPNFFRLVLQNSC---LEESDMVYFL 565

  Fly   499 DEIERLGEKI 508
            ||||.|.:.:
  Fly   566 DEIESLAQNL 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 190/412 (46%)
bNP_001246025.1 AAT_I 128..499 CDD:302748 172/374 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45677
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.