DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and GADL1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_997242.2 Gene:GADL1 HGNCID:27949 Length:521 Species:Homo sapiens

Alignment Length:485 Identity:233/486 (48%)
Similarity:332/486 (68%) Gaps:23/486 (5%)


  Fly    24 ILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHY 88
            |:|.|  :|:..|.         .:|:..:..|::||:|::|::|::.. ...::.|||:.||||
Human    56 IMEEV--VLKATDV---------NEKVCEWRPPEQLKQLLDLEMRDSGE-PPHKLLELCRDVIHY 108

  Fly    89 SVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEGD 153
            ||||:|.||.|||:..||.:.|....:|||:|.|.|||||:|||.|:|..|:..:.:..|:||||
Human   109 SVKTNHPRFFNQLYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGD 173

  Fly   154 GIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVS 218
            |||.||||.||||.|.|||||..|::|..|:.|...|:||||.|.|||..|||::||:|:.|...
Human   174 GIFNPGGSVSNMYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCF 238

  Fly   219 VRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDAC 283
            |.|:.||:|:.::||.::.:|:..|..||.|..|:|||||||||.::..||:.|||.|||||||.
Human   239 VETDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHVDAS 303

  Fly   284 LGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQD 348
            .||:||:|.|:|.|:.|:.||:|.:|||||.:.|.:||...|.::...||::|.|.:|.||||||
Human   304 WGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAKASYLFQQD 368

  Fly   349 KFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGL--MVDHAIHIARLLEGKLRQRGDRFR 411
            ||||||||||:||:||.|:.||||||:..||  .|..||  .|:.|:.::|.|..::::| :.|:
Human   369 KFYDVSYDTGDKSIQCSRRPDAFKFWMTWKA--LGTLGLEERVNRALALSRYLVDEIKKR-EGFK 430

  Fly   412 LVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLG 476
            |:: |.||:|:|||:||.::|  ..||.||:|::|..|||.|||:|...|:||:||.|.:.|  .
Human   431 LLM-EPEYANICFWYIPPSLR--EMEEGPEFWAKLNLVAPAIKERMMKKGSLMLGYQPHRGK--V 490

  Fly   477 NFFRMVFTCFPILKSKELDFILDEIERLGE 506
            ||||.| ...|.:..:::||:||||:.||:
Human   491 NFFRQV-VISPQVSREDMDFLLDEIDLLGK 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 206/409 (50%)
GADL1NP_997242.2 AAT_I 77..445 CDD:302748 190/373 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3597
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45677
Phylome 1 0.910 0.690 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.