DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and HDC

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_016877583.1 Gene:HDC HGNCID:4855 Length:697 Species:Homo sapiens

Alignment Length:420 Identity:99/421 (24%)
Similarity:172/421 (41%) Gaps:80/421 (19%)


  Fly    47 KQKIVPFLQPDKLKELINLKVRE---TENCSLAEIEELCQQ-VIHYSVKTSHGRFHNQLFGQLDP 107
            ::::.|.:||..|:..:.....|   :.:....:||.:... |:|:.....|.     .:..|..
Human    27 ERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHA-----YYPALTS 86

  Fly   108 F-GLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKE----------GDGIFAPGGS 161
            : .|.|.::.:|:|...:|:..:|..:.:|..|:..:.|:.|..|          |.|:.....|
Human    87 WPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSSQGGGVLQSTVS 151

  Fly   162 TSNMYGMVLARYKIAPEVKTSGMFGMRP----------LVLFTSDESHYSFVKAANWLGLGSYNC 216
            .|.:..::.||.....|:|||     .|          ||.:.||::| |.|:.|..:.|.....
Human   152 ESTLIALLAARKNKILEMKTS-----EPDADESCLNARLVAYASDQAH-SSVEKAGLISLVKMKF 210

  Fly   217 VSVRTN--ERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERH----- 274
            :.|..|  .||:.    |:..|.|.|.||..|.||..|.|||.:.|||.::....:::.|     
Human   211 LPVDDNFSLRGEA----LQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPISKAHHPCSP 271

  Fly   275 ------------------------------GLWLHVDACLGGAALLSAKNRSLIAGLERANSFSW 309
                                          |||||:||...|.|.|..:.|..:.|:|.|:||::
Human   272 PLSLARCETSFPTSYLPSGQVMFASSGAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTF 336

  Fly   310 NPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFW 374
            ||.|.:.....|:.|..::..: |::..|....||...:.  .|:.|..:..:...|:..:.|.|
Human   337 NPSKWMMVHFDCTGFWVKDKYK-LQQTFSVNPIYLRHANS--GVATDFMHWQIPLSRRFRSVKLW 398

  Fly   375 LMLKARGYGKYGLMVDHAIHIARLLEGKLR 404
            .::::.|.......|.|...:|:..|..:|
Human   399 FVIRSFGVKNLQAHVRHGTEMAKYFESLVR 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 89/367 (24%)
HDCXP_016877583.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.