DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Sgpl1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_775139.1 Gene:Sgpl1 RGDID:628599 Length:568 Species:Rattus norvegicus

Alignment Length:429 Identity:99/430 (23%)
Similarity:161/430 (37%) Gaps:82/430 (19%)


  Fly    22 WKILEN-VFHLLRKEDTF------CVDPQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAEIE 79
            |...:| :|.|:||....      .:...|.|..|.:|||:.||    ..:|....:..|.||:.
  Rat    67 WSRFKNKLFRLIRKMPFIGRKIQQQLTKAKKDLVKNMPFLKLDK----DYVKTLPAQGLSTAEVL 127

  Fly    80 ELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTY----EVAPVFSLIETEVI 140
            |..::.....|....|:....::.. :|  ....|:.:|....|::.    ::.|....:|.|::
  Rat   128 ERLKEYSSMDVFWQEGKASGAVYSG-EP--KLTELLVQAYGEFTWSNPLHPDIFPGLRKLEAEIV 189

  Fly   141 ATICKL-AGYKEGDGIFAPGGSTSNMYGMVLARYK-IAPEVKTSGMFGMRPLVLFTSDESHYSFV 203
            ...|.| .|..:..|....||:.|.:  |....|: :|.|.      |::...:...:.:|.:|.
  Rat   190 RMTCSLFNGGPDSCGCVTSGGTESIL--MACKAYRDLALEK------GIKTPEIVAPESAHAAFD 246

  Fly   204 KAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAA 268
            |||::.|:     ..||..::..|.:|....|    :|.......:.|:|.....|..|.|...|
  Rat   247 KAAHYFGM-----KIVRVAQKKNMEVDVRAMK----RAISRNTAMLVCSAPQFPHGVIDPIPEVA 302

  Fly   269 DVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERA---------------NSFSWNPHKTIGAP 318
            .:..::.:..||||||||         .||..:|:|               .|.|.:.||...||
  Rat   303 KLAVKYKIPFHVDACLGG---------FLIVFMEKAGYPLEKPFDFRVKGVTSISADTHKYGYAP 358

  Fly   319 LQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTG---NKSVQCGRK---IDAFKFWLML 377
            ...|:.:           .|.|.:..:|  .|.|..:..|   :.|:...|.   |.|  .|..|
  Rat   359 KGSSVVM-----------YSNEKYRKYQ--FFVDADWQGGIYASPSIAGSRPGGIIAA--CWAAL 408

  Fly   378 KARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPE 416
            ...|...|.......|..||.|:.:|....:.|.|..|:
  Rat   409 MHFGENGYVEATKQIIKTARFLKSELENIKNIFILGDPQ 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 78/348 (22%)
Sgpl1NP_775139.1 DOPA_deC_like 146..507 CDD:99743 78/347 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.