DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and GAD1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_000808.2 Gene:GAD1 HGNCID:4092 Length:594 Species:Homo sapiens

Alignment Length:495 Identity:228/496 (46%)
Similarity:318/496 (64%) Gaps:28/496 (6%)


  Fly    23 KILENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKL---KELINLKVRETENCSLAEIEELCQ 83
            ::::.:.:.:||  ||       |:. |::.|..|.:|   .|..||::.:... ||.:|...|:
Human   119 EVVDILLNYVRK--TF-------DRSTKVLDFHHPHQLLEGMEGFNLELSDHPE-SLEQILVDCR 173

  Fly    84 QVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAG 148
            ..:.|.|:|.|.||.|||...||..||||..:|...|.:.:|||:||||.|:|...:..:.::.|
Human   174 DTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVG 238

  Fly   149 Y--KEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGL 211
            :  |:|||||:|||:.||||.::.||||..|||||.||..:..||||||::||||..||...||.
Human   239 WSSKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEQSHYSIKKAGAALGF 303

  Fly   212 GSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGL 276
            |:.|.:.::.||||:::..|.||||.|||.:|..||:||.||||||.||||.|...||:.|::.|
Human   304 GTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIADICEKYNL 368

  Fly   277 WLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEA 341
            ||||||..||..|:|.|:|..:.|:|||||.:|||||.:|..||||..|.:|.| :|:.||...|
Human   369 WLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKEKG-ILQGCNQMCA 432

  Fly   342 HYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQR 406
            .||||.||.||||||||:|::||||.:|.||||||.||:|...:...::..:.:|..|..|::.|
Human   433 GYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNR 497

  Fly   407 GDRFRLVI---PEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYS 468
             :.|.:|.   |||  :|||||:||:::|  ...::|:...:|:.||||||..|..|||.|:||.
Human   498 -EEFEMVFNGEPEH--TNVCFWYIPQSLR--GVPDSPQRREKLHKVAPKIKALMMESGTTMVGYQ 557

  Fly   469 PLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            |...|  .||||||.: .|.....::||:::||||||:.:
Human   558 PQGDK--ANFFRMVIS-NPAATQSDIDFLIEEIERLGQDL 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 205/412 (50%)
GAD1NP_000808.2 Pyridoxal_deC 144..518 CDD:278699 186/379 (49%)
Substrate binding 190..192 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.