DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5618 and GAD1

DIOPT Version :10

Sequence 1:NP_649211.1 Gene:CG5618 / 40241 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_000808.2 Gene:GAD1 / 2571 HGNCID:4092 Length:594 Species:Homo sapiens


Alignment Length:52 Identity:10/52 - (19%)
Similarity:18/52 - (34%) Gaps:7/52 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HTAVSKSSQSTSINSSSPEAKRCKLASES-SPGDSCSNIDFVQVKAPTALEV 116
            |::.|:....|      |....|.:..:. :|......:...:...||..||
Human     6 HSSTSRGWPGT------PRLSACAMTRDDVTPPRPAFGLPRAKSSQPTGREV 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 GadA 56..507 CDD:439846 10/52 (19%)
GAD1NP_000808.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/22 (18%)
Pyridoxal_deC 144..518 CDD:395219
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.