DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Tdc2

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_724489.1 Gene:Tdc2 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster

Alignment Length:414 Identity:106/415 (26%)
Similarity:186/415 (45%) Gaps:62/415 (15%)


  Fly    46 DKQKIVPFLQPDKLKELINLKV-RETENCS--LAEIEE-LCQQVIHYSVKTSHGRFHNQLFGQLD 106
            :::::.|.::|..|:.|:..:. :|.|:..  :.::|: :...|.|:    .|.|||...     
  Fly    25 NERRVTPSVEPGYLRHLLPPEAPQEPEDWDQIMRDVEDKIMPGVTHW----QHPRFHAYF----- 80

  Fly   107 PFG-----LAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAG-------YKEGD---GIF 156
            |.|     :.|.::.:.:....:::..:|..:.:||.|:..:.|..|       .|||.   |:.
  Fly    81 PAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKEGSTGGGVI 145

  Fly   157 APGGSTSNMYGMVLARYKIAPEVKTSGMFG-----MRPLVLFTSDESHYSFVKAANWLGLGSYNC 216
            ....|...:..|:.||.:....:|....|.     :..|:.:.|.|:|....|||       ..|
  Fly   146 QTSASECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAA-------MIC 203

  Fly   217 -VSVRTNE-------RGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTER 273
             |.:|..|       |||.:.:.:|    |.:.:|..||||:.|.|||...|||::.......:|
  Fly   204 FVKLRILEPDDDASLRGQTIYEAME----EDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQLQR 264

  Fly   274 H-GLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCN 337
            . |:||||||...|.:.:..:.:.|:.|:|.|:||:.||:|.:.....||....|:..||   .:
  Fly   265 FPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFNTNPNKWLLTNFDCSTLWVRDRIRL---TS 326

  Fly   338 STEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLM--VDHAIHIARLLE 400
            :.....|:.:..:.|.:.|..:..|...|:..:.|.|.:|  |.||..||.  :.|.|.:|:..|
  Fly   327 ALVVDPLYLKHGYSDAAIDYRHWGVPLSRRFRSLKLWFVL--RSYGISGLQHYIRHHIKLAKRFE 389

  Fly   401 GKLRQRGDRFRLVIPEHEYSNVCF 424
             :|..:..||. :..:.:...|||
  Fly   390 -ELVLKDKRFE-ICNQVKLGLVCF 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 95/360 (26%)
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 105/405 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.