DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Csad

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_017172101.1 Gene:Csad MGIID:2180098 Length:500 Species:Mus musculus

Alignment Length:367 Identity:185/368 (50%)
Similarity:258/368 (70%) Gaps:2/368 (1%)


  Fly    48 QKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAG 112
            :|:..:.:|::||:|::|:: :::..|..:|.|.|:.||||||||.|.||.||||..|||..|||
Mouse    41 EKVCEWKEPEELKQLLDLEL-QSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAG 104

  Fly   113 ALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAP 177
            .::||::|.|.||||:||||.|:|.||:..:..|.|:..|||:|.||||.||||.|.|||::..|
Mouse   105 RIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYP 169

  Fly   178 EVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKAR 242
            :.|..|:..:.||.||||.|.|||..|.|.:||||:.:...|:.:|||:|:.:|||.:|..|:|.
Mouse   170 DCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAE 234

  Fly   243 GGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSF 307
            |..||.|:.|:|||||||||.::..|||.:|||||.||||..||:.|||..:|.|:.|::||:|.
Mouse   235 GSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSV 299

  Fly   308 SWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFK 372
            :|||||.:.|.||||..|.|::..||:||:.::|.|||||||||||:.|||:|.|||||::|..|
Mouse   300 AWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLK 364

  Fly   373 FWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVI 414
            .|||.||:|.......:|.|..:.|.|..::::| :.|.||:
Mouse   365 LWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKR-EGFELVM 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 165/319 (52%)
CsadXP_017172101.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45677
Phylome 1 0.910 0.690 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.