DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Gad2

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_036695.1 Gene:Gad2 RGDID:2653 Length:585 Species:Rattus norvegicus

Alignment Length:490 Identity:212/491 (43%)
Similarity:314/491 (64%) Gaps:21/491 (4%)


  Fly    25 LENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHY 88
            |::|.::|.:   :.|  :.:|:. |::.|..|::|.:..|.::.:... :|.||...||..:.|
  Rat   111 LQDVMNILLQ---YVV--KSFDRSTKVIDFHYPNELLQEYNWELADQPQ-NLEEILTHCQTTLKY 169

  Fly    89 SVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYK--E 151
            ::||.|.|:.|||...||..|||...:|...|.:.:|||:||||.|:|...:..:.::.|:.  .
  Rat   170 AIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGS 234

  Fly   152 GDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNC 216
            |||||:|||:.||||.|::||||:.||||..||..:..|:.|||:.||:|..|.|..||:|:.:.
  Rat   235 GDGIFSPGGAISNMYAMLIARYKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSV 299

  Fly   217 VSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVD 281
            :.::.:|||:|:..|||.:|.|.|.:|..||.|:.||||||.||||.:...||:.:::.:|:|||
  Rat   300 ILIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVD 364

  Fly   282 ACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQ 346
            |..||..|:|.|::..:.|:|||||.:|||||.:|.|||||..|.||.| |::.||...|.||||
  Rat   365 AAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEG-LMQSCNQMHASYLFQ 428

  Fly   347 QDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFR 411
            |||.||:|||||:|::||||.:|.||.|||.:|:|...:...:|..:.:|..|...::.| :.:.
  Rat   429 QDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEYLYNIIKNR-EGYE 492

  Fly   412 LVI---PEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAK 473
            :|.   |:|  :||||||:|.::||..:.|  |..|||..|||.||.:|...||.|:.|.||..|
  Rat   493 MVFDGKPQH--TNVCFWFVPPSLRVLEDNE--ERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDK 553

  Fly   474 NLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
              .||||||.: .|....:::||:::||||||:.:
  Rat   554 --VNFFRMVIS-NPAATHQDIDFLIEEIERLGQDL 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 190/412 (46%)
Gad2NP_036695.1 Pyridoxal_deC 138..509 CDD:278699 169/376 (45%)
Substrate binding. {ECO:0000250} 181..183 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.