DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Gad1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_058703.1 Gene:Gad1 RGDID:2652 Length:593 Species:Rattus norvegicus

Alignment Length:495 Identity:228/496 (46%)
Similarity:318/496 (64%) Gaps:28/496 (6%)


  Fly    23 KILENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKL---KELINLKVRETENCSLAEIEELCQ 83
            ::::.:.:.:||  ||       |:. |::.|..|.:|   .|..||::.:... ||.:|...|:
  Rat   118 EVVDILLNYVRK--TF-------DRSTKVLDFHHPHQLLEGMEGFNLELSDHPE-SLEQILVDCR 172

  Fly    84 QVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAG 148
            ..:.|.|:|.|.||.|||...||..||||..:|...|.:.:|||:||||.|:|...:..:.::.|
  Rat   173 DTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIG 237

  Fly   149 Y--KEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGL 211
            :  |:|||||:|||:.||||.::.||||..|||||.||..:..||||||:.||||..||...||.
  Rat   238 WSNKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGF 302

  Fly   212 GSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGL 276
            |:.|.:.::.||||:::..||||||.:||.:|..|.:||.||||||.||||.|...||:.|::.|
  Rat   303 GTDNVILIKCNERGKIIPADLEAKILDAKQKGFVPLYVNATAGTTVYGAFDPIQEIADICEKYNL 367

  Fly   277 WLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEA 341
            ||||||..||..|:|.|:|..::|:|||||.:|||||.:|..||||..|.:|.| :|:.||...|
  Rat   368 WLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEKG-ILQGCNQMCA 431

  Fly   342 HYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQR 406
            .||||.||.||||||||:|::||||.:|.||||||.||:|...:...::..:.:|..|..|::.|
  Rat   432 GYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNR 496

  Fly   407 GDRFRLVI---PEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYS 468
             :.|.:|.   |||  :|||||:||:::|  ...::||...:|:.||||||..|..|||.|:||.
  Rat   497 -EEFEMVFNGEPEH--TNVCFWYIPQSLR--GVPDSPERREKLHRVAPKIKALMMESGTTMVGYQ 556

  Fly   469 PLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            |...|  .||||||.: .|.....::||:::||||||:.:
  Rat   557 PQGDK--ANFFRMVIS-NPAATQSDIDFLIEEIERLGQDL 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 205/412 (50%)
Gad1NP_058703.1 Pyridoxal_deC 143..517 CDD:278699 185/379 (49%)
Substrate binding. {ECO:0000250} 189..191 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.