DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Ddc

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_008768473.1 Gene:Ddc RGDID:2494 Length:512 Species:Rattus norvegicus

Alignment Length:454 Identity:114/455 (25%)
Similarity:194/455 (43%) Gaps:88/455 (19%)


  Fly     7 GAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINL---KVR 68
            |.|.||.|.|       .|:.:                 :.:.:.|.::|..|:.||..   :..
  Rat    42 GKEMVDYIAD-------YLDGI-----------------EGRPVYPDVEPGYLRALIPTTAPQEP 82

  Fly    69 ETENCSLAEIEELCQQ-VIHYSVKTSHGRFHNQLFGQLDPFGLA-GALVTEAMNGST----YTYE 127
            ||....:.:||::... |.|:         |:..|....|...: .|::.:.:.|:.    :::.
  Rat    83 ETYEDIIRDIEKIIMPGVTHW---------HSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWA 138

  Fly   128 VAPVFSLIETEVIATICK--------LAGYK-EGDGIFAPGGSTSNMYGMVLARYKI-------A 176
            .:|..:.:||.::..:.|        |||.. ||.|:.....|.:.:..::.||.|:       :
  Rat   139 ASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKMIRQLQAAS 203

  Fly   177 PEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGL-GSYNCVSVRTNERGQMLLDDLEAKIAEAK 240
            ||:..:.:  |..||.:|||::|.|..:|    || |.....::.::....|....|...:...|
  Rat   204 PELTQAAL--MEKLVAYTSDQAHSSVERA----GLIGGVKIKAIPSDGNYSMRAAALREALERDK 262

  Fly   241 ARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERAN 305
            |.|..||||..|.|||...:||::.....:..:.|:|||:||...|:|.:..:.|.|:.|:|.|:
  Rat   263 AAGLIPFFVVVTLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFAD 327

  Fly   306 SFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFY--DVSYDTG------NKSV 362
            ||::||||.:.....||....:      :|.:.|||   |..|..|  ....|:|      :..:
  Rat   328 SFNFNPHKWLLVNFDCSAMWVK------KRTDLTEA---FNMDPVYLRHSHQDSGLITDYRHWQI 383

  Fly   363 QCGRKIDAFKFWLMLKARGYGKYGLM--VDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCF 424
            ..||:..:.|.|.:.  |.||..||.  :...:.::...|..:|| ..||. :..|.....|||
  Rat   384 PLGRRFRSLKMWFVF--RMYGVKGLQAYIRKHVKLSHEFESLVRQ-DPRFE-ICTEVILGLVCF 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 96/361 (27%)
DdcXP_008768473.1 Pyridoxal_deC 67..446 CDD:278699 106/406 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.