| Sequence 1: | NP_649211.1 | Gene: | CG5618 / 40241 | FlyBaseID: | FBgn0036975 | Length: | 510 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_766078.1 | Gene: | Sepsecs / 211006 | MGIID: | 1098791 | Length: | 504 | Species: | Mus musculus | 
| Alignment Length: | 390 | Identity: | 87/390 - (22%) | 
|---|---|---|---|
| Similarity: | 126/390 - (32%) | Gaps: | 118/390 - (30%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    30 HLLR--KEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETE----NCSLAEIEELCQQVIHY 88 
  Fly    89 SVKTSHGRFHNQLFGQLDPFGLAG--ALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKE 151 
  Fly   152 GDGIFAPGGSTSNMYGMVL-------------ARYKIAPEVKTSGMF------GMRPLVLFTSDE 197 
  Fly   198 SHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGA-- 260 
  Fly   261 -FDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLI---AGLERANSFSWNPHKTIGAPLQC 321 
  Fly   322 SLFLTRESGRLLERCNSTEAHYLFQQD--KFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGK 384 
  Fly   385  384 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG5618 | NP_649211.1 | AAT_I | 97..504 | CDD:302748 | 68/317 (21%) | 
| Sepsecs | NP_766078.1 | Tetramerization. /evidence=ECO:0000269|PubMed:18093968 | 1..44 | 5/14 (36%) | |
| selenium_SpcS | 13..458 | CDD:211833 | 87/390 (22%) | ||
| Phosphate loop (P-loop). /evidence=ECO:0000269|PubMed:18093968 | 96..106 | 3/9 (33%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0076 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||