DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Sepsecs

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_766078.1 Gene:Sepsecs MGIID:1098791 Length:504 Species:Mus musculus

Alignment Length:390 Identity:87/391 (22%)
Similarity:126/391 (32%) Gaps:118/391 (30%)


  Fly    30 HLLR--KEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETE----NCSLAEIEELCQQVIHY 88
            ||:|  .|...|.: ..||:..:..||.        .|.|.::.    ||.:.|.|   .:|...
Mouse    30 HLIRLLLEQGKCPE-DGWDESTLELFLH--------ELAVMDSNNFLGNCGVGERE---GRVASA 82

  Fly    89 SVKTSHGRFHNQLFGQLDPFGLAG--ALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAGYKE 151
            .|...|.||       :...|.:|  :.|.....||:       :.:.|...::..:.||||...
Mouse    83 LVARRHYRF-------IHGIGRSGDISAVQPKAAGSS-------LLNKITNSLVLNVIKLAGVHS 133

  Fly   152 GDGIFAPGGSTSNMYGMVL-------------ARYKIAPEVKTSGMF------GMRPLVLFTSDE 197
            ....|....:|    ||.|             |:|.|.|.:.....|      |..|:|:     
Mouse   134 VASCFVVPMAT----GMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVI----- 189

  Fly   198 SHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGA-- 260
                    .|.|              .|..|..||:|  .|||.:...|..:.|...||...|  
Mouse   190 --------ENVL--------------EGDELRTDLKA--VEAKIQELGPEHILCLHSTTACFAPR 230

  Fly   261 -FDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLI---AGLERANSFSWNPHKTIGAPLQC 321
             .|.:...|.:...:.:...|:...|   |.|:|...||   |.:.|.::|..:..|....|:  
Mouse   231 VPDRLEELAVICANYDIPHVVNNAYG---LQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPV-- 290

  Fly   322 SLFLTRESGRLLERCNSTEAHYLFQQD--KFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGK 384
                   .|.::...|..     |.||  |.|     .|..|  ....:|.....|.|...||.|
Mouse   291 -------GGAIIAGFNEP-----FIQDISKMY-----PGRAS--ASPSLDVLITLLSLGCSGYRK 336

  Fly   385  384
            Mouse   337  336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 68/318 (21%)
SepsecsNP_766078.1 Tetramerization. {ECO:0000269|PubMed:18093968} 1..44 5/15 (33%)
selenium_SpcS 13..458 CDD:211833 87/391 (22%)
Phosphate loop (P-loop). {ECO:0000269|PubMed:18093968} 96..106 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.