DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and spl-3

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_500051.2 Gene:spl-3 WormBaseID:WBGene00022427 Length:606 Species:Caenorhabditis elegans

Alignment Length:432 Identity:89/433 (21%)
Similarity:147/433 (34%) Gaps:118/433 (27%)


  Fly    23 KILENVFHLLRKEDTFCVDPQKWDKQKIVPFL------------QPDKLKELINLKVRETENCSL 75
            :|.:::|..||.        ..|.::|:...|            |.|.::|.....   .|.|  
 Worm    67 QIRKSIFSFLRS--------LPWVRRKLEADLAKAQAEIEDEVHQSDHMREFYKFL---PERC-- 118

  Fly    76 AEIEELC------------QQVIHY-------SVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNG 121
            .:.||:.            :.:.||       .:|.|...|  .||...||              
 Worm   119 MDTEEILADGRRYAMMGERRYMQHYDPQTREEDMKLSAKLF--DLFAHTDP-------------- 167

  Fly   122 STYTYEVAPVFSLIETEVIATICKL-AGYKEGDGIFAPGGSTSNMYGMVLARYK----------- 174
              :..:..|....:|.|::...|.: .|.|:..|:.|.||:.:.|...:..|.:           
 Worm   168 --HRSDAFPGVRKMEAEILKMTCAMFHGGKDSCGVVAGGGTEALMLACLAYRNRSRARGEWRAEI 230

  Fly   175 IAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKI-AE 238
            :||..                  :|.:..|||.:..:         |.:|.|:...|..|.: |.
 Worm   231 VAPST------------------AHPALDKAAAFFDM---------TIKRIQVSETDDRANVGAM 268

  Fly   239 AKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAAL--LSAKNRSLIA-- 299
            .:|.|.....:..:|...:.|..|.|...|.:.:|:.:.||||..|||..|  :...:.|:.|  
 Worm   269 KRAIGPRTCMIIASAPNHITGTVDPIEKLAKLAQRYHIPLHVDCTLGGFVLPFMEYADYSVPAFD 333

  Fly   300 -GLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQ 363
             .|....|.|.:.|:....|.:.|:.:.||...|        .|..|...::....|.|  .::.
 Worm   334 FRLPGVTSISADLHRYGQCPGRLSVLMYREPAFL--------RHQFFTNSEWPGGCYAT--PTMS 388

  Fly   364 CGRKIDAF-KFWLMLKARGYGKYGLMVDHAIHIARLLEGKLR 404
            .||...|. ..|.|:..:|...|.......|...|.|..:|:
 Worm   389 GGRDGGAVATAWAMMLRKGRDGYINAAQRIIEATRQLAYRLQ 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 71/328 (22%)
spl-3NP_500051.2 DOPA_deC_like 147..502 CDD:99743 73/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.