DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and hdl-2

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_501539.3 Gene:hdl-2 WormBaseID:WBGene00006409 Length:611 Species:Caenorhabditis elegans

Alignment Length:555 Identity:108/556 (19%)
Similarity:187/556 (34%) Gaps:150/556 (27%)


  Fly    30 HLLRKEDTFCVD--PQKWDKQK----------------IVPFL---------QP-----DKLKEL 62
            |:||.|:....:  .|:.|:||                :|.|:         ||     |.....
 Worm    88 HVLRSENQAPTNEIQQRSDRQKLQEPIGKNEFIKCMSLVVQFINDYFDESHKQPVIPENDVNSSR 152

  Fly    63 INLKVRETENCSLAEI-EELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTY 126
            |::||.|... .|.|| ::|.:.||.....|.|.|:|.:..|:    .||..:.:.......:..
 Worm   153 IHVKVPEKAE-ELTEILKDLKEIVIPNICHTHHPRYHAKFAGK----SLADLVASTISAALGHDV 212

  Fly   127 EVAPVFSLIETEVIATICK-LAGYKEGDGIFAPGGSTSNMYGMV----------LARYKIAPEVK 180
            ..:|:...||    ..||| |:.......|.:..|...:..|.|          :.|:.|....|
 Worm   213 NSSPIIESIE----RIICKWLSTSMAIPQIKSSLGELRDPIGTVFYTPCDVFISVIRHAIEKFEK 273

  Fly   181 T-SGMFGMR--PLVLFTSDESHYSFVKAANWLGLGSYNCVSVR-------TNER------GQMLL 229
            | ||....:  ..:::.||:|.....:.          |:|.|       |:|:      ...||
 Worm   274 TDSGKERSKNADYIVYCSDDSQVPLKEP----------CISCRVKLRKVITDEKNGSGMTSANLL 328

  Fly   230 DDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKN 294
            ..:|..|    |||..|..:....|:..:.|.|:|.....|:....:|||:||...|...|.:.:
 Worm   329 KQMEKDI----ARGFTPLVIIANYGSANIAANDEIWDLVTVSRSKKIWLHLDASYAGCEWLDSNS 389

  Fly   295 RSLIAGLERANSFSWNPHKTI----GAPLQCSLFLTRESGRL--LERCNSTEAHYLFQQDKFYDV 353
            |:             |.|..|    ...:.|| .|...|||:  :..|...|..           
 Worm   390 RN-------------NVHALISEVHSVHITCS-SLFPYSGRISVVWSCEKLELD----------- 429

  Fly   354 SYDTGNKSVQCGRKI----DAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVI 414
                       |.||    ...:.|::::..|.......|...|.:......::......|.:  
 Worm   430 -----------GAKILYGEHPIRLWILIRLHGIRSIREAVKRKIILGNAFSERMSHHSQLFEM-- 481

  Fly   415 PEH--EYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIG----YSPLKAK 473
             .|  |:....|.:..|.::..:|:..        .:.......:..|.||...    :..:..|
 Worm   482 -HHTNEHGVTVFQYKNKKIKDRTEDTN--------KITSMFHNYLVLSSTLKFSIVSFHGKVLIK 537

  Fly   474 NLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            ::.|:.|    |...:..:.:..:::.::...|.:
 Worm   538 SVVNYGR----CNLSIMDESVSTLVNSVDEFEEAL 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 81/450 (18%)
hdl-2NP_501539.3 AAT_I 125..527 CDD:302748 95/472 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.