DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and spl-2

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_505372.1 Gene:spl-2 WormBaseID:WBGene00006418 Length:542 Species:Caenorhabditis elegans

Alignment Length:520 Identity:97/521 (19%)
Similarity:169/521 (32%) Gaps:159/521 (31%)


  Fly    49 KIVPFLQ----------PDKLKELINLKVRETE------NCSLAEIEELCQQVIHYSVKTS---H 94
            |.|||::          .|:|::.:.:..|.||      :.|:...|.|....|:..::..   .
 Worm    64 KRVPFIRKMIDKQLNEVKDELEKSLRIVDRSTEYFTTIPSHSVGRTEVLRLAAIYDDLEGPAFLE 128

  Fly    95 GRFHNQLFGQLDPFGLAGALVTEAMNGSTYTY----EVAPVFSLIETEVIATICKLA-GYKEGDG 154
            ||....:|.:.|... ...:..|......:|.    ::.|...::|.||:...|.:. |..|..|
 Worm   129 GRVSGAVFNREDDKD-EREMYEEVFGKFAWTNPLWPKLFPGVRIMEAEVVRMCCNMMNGDSETCG 192

  Fly   155 IFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSV 219
            ..:.|||.|.:...:..|.::...       |.:...:......|.:|.|||        .|..:
 Worm   193 TMSTGGSISILLACLAHRNRLLKR-------GEKYTEMIVPSSVHAAFFKAA--------ECFRI 242

  Fly   220 RTNERGQMLLDDLEAKIAEAKAR-----------GGEPFFVNCTAGTTVLGAFDDINGAADVTER 273
            :..   ::.:|.:..|:...|.:           |..|.|        ..|..|||.....:...
 Worm   243 KVR---KIPVDPVTFKVDLVKMKAAINKRTCMLVGSAPNF--------PFGTVDDIEAIGQLGLE 296

  Fly   274 HGLWLHVDACLGGAALLSAKNRSL-----IAGLERANSFSWNPHKTIGAPLQCSLFL-------- 325
            :.:.:||||||||..|...:...:     :.|:   :|.|.:.||...||...|:.|        
 Worm   297 YDIPVHVDACLGGFLLPFLEEDEIRYDFRVPGV---SSISADSHKYGLAPKGSSVVLYRNKELLH 358

  Fly   326 -----------------TRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKI----- 368
                             |.|..|.........|..|:...:.|..:   ..|.|...|||     
 Worm   359 NQYFCDADWQGGIYASATMEGSRAGHNIALCWAAMLYHAQEGYKAN---ARKIVDTTRKIRNGLS 420

  Fly   369 ------------------------DAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDR 409
                                    :.::|...:|.:.:...||.....:||              
 Worm   421 NIKGIKLQGPSDVCIVSWTTNDGVELYRFHNFMKEKHWQLNGLQFPAGVHI-------------- 471

  Fly   410 FRLVIPEHEYSNVCFWFIP---------KAMRVSSEEETPEWWSRLYTVAPKIKE-----QMAHS 460
              :|...|.:..:...|:.         |:.:.|..::|.|  :.:|.:|..|.:     :.|||
 Worm   472 --MVTMNHTHPGLAEAFVADCRAAVEFVKSHKPSESDKTSE--AAIYGLAQSIPDRSLVHEFAHS 532

  Fly   461  460
             Worm   533  532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 82/454 (18%)
spl-2NP_505372.1 DOPA_deC_like 130..493 CDD:99743 73/412 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.