DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and hdl-1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_502265.2 Gene:hdl-1 WormBaseID:WBGene00001839 Length:905 Species:Caenorhabditis elegans

Alignment Length:458 Identity:108/459 (24%)
Similarity:178/459 (39%) Gaps:86/459 (19%)


  Fly     3 ESVD-GAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLK 66
            |.|| ...:.||.|:.       .:.|...|.|:|      :.....:..|.|:|..||.|:..|
 Worm   336 EEVDVNGMSRDQFRNA-------AKKVVDYLMKQD------ESIRAARCSPALKPGYLKALLPPK 387

  Fly    67 VRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAG----ALVTEAMNG----ST 123
            ..:........:|:..:.::.....:||..||:        |..||    .|:.:.:.|    :.
 Worm   388 APQKAEDIDDILEDYHKLIVPGLSHSSHPNFHS--------FYPAGNSFHCLLADLLGGHIGDAG 444

  Fly   124 YTYEVAPVFSLIET-------EVIATICKLAGYKE---GDGIFAPGGSTSNMYGMVLARYKIAPE 178
            :.:...|..:.:|.       |::|...:...:.|   |.|......:.||...:|.||..:...
 Worm   445 FYWTSNPALTELEVLMMDWLGEMMALPKEFLLFPEASRGGGCMQRSDTESNFLVLVAARTDMIRR 509

  Fly   179 VK-------TSGMFGMRPLVLFTSDESHYSF-VKAANWLGLGSYNCVSVRTNERGQMLL---DDL 232
            :|       :|.:  :..||.:||.::..|. :|.|..:.:     |.:|.....|..:   |.|
 Worm   510 MKQRDKRLRSSDI--LARLVAYTSSDARRSIKMKMAAEVAM-----VKMRVLPTDQNFILRGDTL 567

  Fly   233 EAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSL 297
            .|.|.....||..||||....||:...:||.::....|...||.||||||...|.||:..:.|.|
 Worm   568 HAAIMADIERGLIPFFVGANFGTSGPCSFDHLHELGPVCREHGTWLHVDAAYAGTALICPEIRGL 632

  Fly   298 IAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSV 362
            :.|::.|:||...|.|.|.|.........|:..:|...  |.|.|            .|...|.:
 Worm   633 MRGIDWADSFCTTPSKLIIAVCDVCCLWVRDRHKLQHA--SLENH------------PDLPFKGL 683

  Fly   363 QCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSN------ 421
            ...:::.|.|.|.|:::.|.......:...|.:.:::. |:.|:..||       |..|      
 Worm   684 PTSQRVGALKIWFMIRSFGVENLQNQIREHIRLGQVMT-KILQKDLRF-------EVCNKVVMGL 740

  Fly   422 VCF 424
            :||
 Worm   741 ICF 743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 88/364 (24%)
hdl-1NP_502265.2 Pyridoxal_deC 377..746 CDD:278699 96/405 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.