DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and spl-1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_499913.1 Gene:spl-1 WormBaseID:WBGene00004981 Length:552 Species:Caenorhabditis elegans

Alignment Length:421 Identity:98/422 (23%)
Similarity:159/422 (38%) Gaps:100/422 (24%)


  Fly    28 VFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKT 92
            ||.||||.      |...||.:.....:..||.|.|:...::.:..|...|..|.|..|....| 
 Worm    67 VFSLLRKL------PAVRDKIEKELAAEKPKLIESIHKDDKDKQFISTLPIAPLSQDSIMELAK- 124

  Fly    93 SHGRFHNQLFGQLDPFGLAGALVT----EAMN--GSTYTY---------EVAPVFSLIETEVIAT 142
               ::.:.....:|...::||:.|    |.:|  |..|..         :|.|....:|.|:|..
 Worm   125 ---KYEDYNTFNIDGGRVSGAVYTDRHAEHINLLGKIYEKYAFSNPLHPDVFPGARKMEAELIRM 186

  Fly   143 ICKL-AGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAA 206
            :..| .|.::..|....||:.|    :::|.:.......:.|:  ..|::| ....:|.:|.|||
 Worm   187 VLNLYNGPEDSSGSVTSGGTES----IIMACFSYRNRAHSLGI--EHPVIL-ACKTAHAAFDKAA 244

  Fly   207 NWLGL-------GSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDI 264
            :..|:       .|.|.|.::..||   |:|.....:.     |..|.|.:        |..|.|
 Worm   245 HLCGMRLRHVPVDSDNRVDLKEMER---LIDSNVCMLV-----GSAPNFPS--------GTIDPI 293

  Fly   265 NGAADVTERHGLWLHVDACLGGAALLSAKNRS-LIAGLERAN----SFSWNPHKTIGAPLQCSLF 324
            ...|.:.:::|:.:||||||||..:....:.. ||...:..|    |.|.:.||....|...|:.
 Worm   294 PEIAKLGKKYGIPVHVDACLGGFMIPFMNDAGYLIPVFDFRNPGVTSISCDTHKYGCTPKGSSIV 358

  Fly   325 LTRESGRLLERCNSTEAHYLFQQDKFYDVS------YDT---------GNKSVQCGRKIDAFKFW 374
            :.|          |.|.|: ||   ::.|:      |.|         .|.:|.          |
 Worm   359 MYR----------SKELHH-FQ---YFSVADWCGGIYATPTIAGSRAGANTAVA----------W 399

  Fly   375 LMLKARGYGKYGLMVDHAIHIARLLEGKLRQ 405
            ..|.:.|..:|.......:...|:|..|:.:
 Worm   400 ATLLSFGRDEYVRRCAQIVKHTRMLAEKIEK 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 79/353 (22%)
spl-1NP_499913.1 DOPA_deC_like 138..501 CDD:99743 78/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.