DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and unc-25

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_499689.1 Gene:unc-25 WormBaseID:WBGene00006762 Length:508 Species:Caenorhabditis elegans

Alignment Length:515 Identity:213/516 (41%)
Similarity:312/516 (60%) Gaps:27/516 (5%)


  Fly     8 AETVDQIRDGLM--------DDW----KILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLK 60
            |:..|.:.:.|:        .:|    :.|..:..:|.|   :..|....| |||:.|..|||::
 Worm     6 ADESDAVLENLIAKEILPQTGNWEGTEEFLNRIVQVLLK---YIKDQNDRD-QKILEFHHPDKMQ 66

  Fly    61 ELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYT 125
            .|::|.:.|... ||.::.:.|:.|:...|:|.|.||.||:...||...:||..:|...|.:.:|
 Worm    67 MLMDLSIPEKPE-SLLKLVKSCEDVLRLGVRTGHPRFFNQISCGLDLVSMAGEWLTATANTNMFT 130

  Fly   126 YEVAPVFSLIETEVIATICKLAGY--KEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMR 188
            ||:||||.|:|..|:|.:.:..|:  ::.||||||||:.:|:|.|..||:::.|..|..||..:.
 Worm   131 YEIAPVFILMEKSVMARMWEAVGWDPEKADGIFAPGGAIANLYAMNAARHQLWPRSKHLGMKDIP 195

  Fly   189 PLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTA 253
            .|..|||::||||...|:..||:|:..|.::.|::.|:|:.:.|||||.|.|..|..|||..|||
 Worm   196 TLCCFTSEDSHYSIKSASAVLGIGADYCFNIPTDKNGKMIPEALEAKIIECKKEGLTPFFACCTA 260

  Fly   254 GTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAP 318
            |:||.||||.:...|::.|||.||.||||..||..|||.::|..:||:|||||.:|||||.:||.
 Worm   261 GSTVYGAFDPLERVANICERHKLWFHVDAAWGGGMLLSPEHRYKLAGIERANSVTWNPHKLMGAL 325

  Fly   319 LQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYG 383
            ||||..|.|:.| ||.:||...|.|||||||.||||:|||:|::||||..|.||.|||.|::|..
 Worm   326 LQCSACLFRQDG-LLFQCNQMSADYLFQQDKPYDVSFDTGDKAIQCGRHNDVFKLWLMWKSKGME 389

  Fly   384 KYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYT 448
            .|...::..:.:|.....::::. :.|.|:|...|:.|:|||::|..:|   ..|..|..:||..
 Worm   390 GYRQQINKLMDLANYFTRRIKET-EGFELIIENPEFLNICFWYVPSKIR---NLEPAEMRARLEK 450

  Fly   449 VAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            :|||||..|...||.|:||.|.|.:  .|||||:.:...|.: ::|||::.||..:||.:
 Worm   451 IAPKIKAGMMQRGTTMVGYQPDKQR--PNFFRMIISNQAITR-EDLDFLIKEIVDIGESL 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 184/409 (45%)
unc-25NP_499689.1 DOPA_deC_like 102..503 CDD:99743 184/409 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.