| Sequence 1: | NP_649211.1 | Gene: | CG5618 / 40241 | FlyBaseID: | FBgn0036975 | Length: | 510 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_499689.1 | Gene: | unc-25 / 176713 | WormBaseID: | WBGene00006762 | Length: | 508 | Species: | Caenorhabditis elegans |
| Alignment Length: | 515 | Identity: | 213/515 - (41%) |
|---|---|---|---|
| Similarity: | 312/515 - (60%) | Gaps: | 27/515 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 AETVDQIRDGLM--------DDW----KILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLK 60
Fly 61 ELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYT 125
Fly 126 YEVAPVFSLIETEVIATICKLAGY--KEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMR 188
Fly 189 PLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTA 253
Fly 254 GTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAP 318
Fly 319 LQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYG 383
Fly 384 KYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYT 448
Fly 449 VAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5618 | NP_649211.1 | AAT_I | 97..504 | CDD:302748 | 184/408 (45%) |
| unc-25 | NP_499689.1 | DOPA_deC_like | 102..503 | CDD:99743 | 184/408 (45%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG62386 | |
| OrthoDB | 1 | 1.010 | - | - | D162307at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000667 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100596 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.830 | |||||