DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and basl-1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_498210.1 Gene:basl-1 WormBaseID:WBGene00015467 Length:509 Species:Caenorhabditis elegans

Alignment Length:432 Identity:87/433 (20%)
Similarity:160/433 (37%) Gaps:75/433 (17%)


  Fly    45 WD---KQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLD 106
            ||   .:|.:|.::|..:::.:......|.........:|.:.:.:.|...:|..|.......:.
 Worm    21 WDGIRTRKPIPDVKPGYIEKSVPSNPPTTPESWEKVFGDLEKVIFNGSSHWNHPHFFAYFSAGIG 85

  Fly   107 PFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAG----YK-----EGDGIFAPGGST 162
            ...:...:::..:....:|:...|..:.:|...:..:..|..    :|     .|.||.....|.
 Worm    86 YHSILADIISSGLGSVGFTWIACPPITELEKITLDWLVDLTSLPVEFKNSHPGHGCGIIQSSASD 150

  Fly   163 SNMYGMVLARYK------------------------------------------IAPEVKTSGMF 185
            |.:..::.||..                                          |.|......:|
 Worm   151 STLIAIMTARAAKVEFIKQNPSTFQWLINSTSEHLRSISYWTPVNRTIHDSTDIITPYYHDPRVF 215

  Fly   186 GMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAK-----IAEAKARGGE 245
              :..|::.:|::|.|..|.|...|:......||    ||.|...::::|     |.:.::||..
 Worm   216 --KNFVMYFTDQAHSSVEKGAMLAGVRFRKLRSV----RGYMENYEMDSKILIDAIEQDRSRGFI 274

  Fly   246 PFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWN 310
            ||.|..|.|||...|.||:.....:.::.||:||      ||.....:.:.|:.||:..:|::.:
 Worm   275 PFMVALTVGTTATCAADDVEKIGQICQKEGLYLH------GAFAFCDEFKYLVNGLKYVDSYNTD 333

  Fly   311 PHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWL 375
            .||.......|.. |..::|....|..:.:..||..:  :...:.|..:..|..||:..:.|.|.
 Worm   334 LHKAGMINFDCCP-LWFKNGTYASRYYNVDPVYLAHE--YQSSNMDYRHLEVPLGRRFRSLKVWF 395

  Fly   376 MLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEH 417
            .::..|..|........:.:| ||..|:...||:|.|..|.|
 Worm   396 TMRNMGVEKIREYQRKTVSLA-LLFTKIIVEGDKFELFTPPH 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 78/378 (21%)
basl-1NP_498210.1 AAT_I 1..508 CDD:302748 87/433 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.