| Sequence 1: | NP_649211.1 | Gene: | CG5618 / 40241 | FlyBaseID: | FBgn0036975 | Length: | 510 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_498210.1 | Gene: | basl-1 / 175779 | WormBaseID: | WBGene00015467 | Length: | 509 | Species: | Caenorhabditis elegans |
| Alignment Length: | 432 | Identity: | 87/432 - (20%) |
|---|---|---|---|
| Similarity: | 160/432 - (37%) | Gaps: | 75/432 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 WD---KQKIVPFLQPDKLKELINLKVRETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLD 106
Fly 107 PFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAG----YK-----EGDGIFAPGGST 162
Fly 163 SNMYGMVLARYK------------------------------------------IAPEVKTSGMF 185
Fly 186 GMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAK-----IAEAKARGGE 245
Fly 246 PFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWN 310
Fly 311 PHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWL 375
Fly 376 MLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEH 417 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5618 | NP_649211.1 | AAT_I | 97..504 | CDD:302748 | 78/377 (21%) |
| basl-1 | NP_498210.1 | AAT_I | 1..508 | CDD:302748 | 87/432 (20%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0076 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||