DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and bas-1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001021151.1 Gene:bas-1 WormBaseID:WBGene00000239 Length:523 Species:Caenorhabditis elegans

Alignment Length:575 Identity:119/576 (21%)
Similarity:200/576 (35%) Gaps:138/576 (24%)


  Fly    19 MDDWKILENVFHLLRKEDTFCVD--PQKWD---KQKIVPFLQPDKLKELINLKVRETENCSLAEI 78
            ||..|        ||.|....:|  ...||   .:|.:|.::|..:.:|:..:...|........
 Worm     1 MDSQK--------LRTEGKKMLDFVADYWDGIRDRKPLPDVKPGYINDLVPAQAPATPEDWAKIF 57

  Fly    79 EELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATI 143
            ::|...|::.:....|..|.......|....:...:::..:.|..:|::..|..:.:|...:..:
 Worm    58 DDLENVVVNGATHWHHPHFFAYFPTALSYQSIMADILSGGIAGIGFTWKSCPSMTELEMSSLDWV 122

  Fly   144 CKLAGYKE---------GDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMF-------------- 185
            ..|.|..|         |.||.....|.|.|..::.||......:|:...|              
 Worm   123 VDLMGLPEHFKNSHNGPGCGIIQSTASDSTMIAIMAARATHVERIKSEPTFMKWVSETGVGKTLK 187

  Fly   186 -------------------------GM-----------RPLVLFTSDESHYSFVKAANWLG---- 210
                                     ||           ...|::.||::|.|..|.|....    
 Worm   188 NIFDRVKVNKTLVARASVTVDDEASGMITPYFHDPTVFERFVMYCSDQAHSSVEKGAMLSAVRMR 252

  Fly   211 --------LGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGA 267
                    ||:|. ||..|          |:..|.|.:|||..||....|.|||.....|.::..
 Worm   253 KLKATRGFLGNYG-VSRET----------LQNAIKEDRARGYIPFMFLATVGTTCSCGVDQVDEL 306

  Fly   268 ADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRL 332
            ..|....||:|||||...|...|..:.:.||.|:|..:||::|.||.......||. :..::|..
 Worm   307 GPVCVEEGLYLHVDAAYAGTFALCEEFKYLIRGMEHVDSFNFNLHKAGMVNFDCSP-MWFKNGTH 370

  Fly   333 LERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIAR 397
            :.|..:.:|.||..:  :...:.|..:..|..||:..:.|.|.:|:..|..|    :...:....
 Worm   371 VSRYFNVDAVYLAHE--YQTTASDYRHLQVALGRRFRSLKIWFVLRNMGVDK----IREYLRRTE 429

  Fly   398 LLE---GKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWS------RLYTVAPKI 453
            ||.   .||.....:|...:|:| ....||     .::.|:..:..:..:      |::.|...:
 Worm   430 LLAAEFSKLILENGKFEHFVPQH-LGLTCF-----RLKNSTNADNEKLCNAINDDRRIHLVPSTV 488

  Fly   454 KEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            .                     |.:|..:..|..:....::.:..|.|..|.||:
 Worm   489 H---------------------GTYFLRMVVCSQLTTLDDIIYARDVIFELAEKL 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 99/487 (20%)
bas-1NP_001021151.1 AAT_I 35..461 CDD:302748 97/450 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.