DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and tdc-1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_495743.1 Gene:tdc-1 WormBaseID:WBGene00006562 Length:705 Species:Caenorhabditis elegans

Alignment Length:455 Identity:110/456 (24%)
Similarity:196/456 (43%) Gaps:70/456 (15%)


  Fly     7 GAETVDQIRDGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQKIVPFLQPDKLKELINLKVRETE 71
            |.||||.|.|       .|||:                 .|:::||.::|..||:||..:...|.
 Worm    86 GKETVDYIVD-------YLENI-----------------QKRRVVPAIEPGYLKDLIPSEAPNTP 126

  Fly    72 NCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFG-----LAGALVTEAMNGSTYTYEVAPV 131
            ....:.:|:..:.::.......|.|||...     |.|     :...::::|:....:::...|.
 Worm   127 ESFESVMEDFEKLIMPGITHWQHPRFHAYF-----PAGNSFPSIIADMLSDAIGCVGFSWAACPA 186

  Fly   132 FSLIETEVIATICKLAGYK----------EGDGIFAPGGSTSNMYGMVLARYKIAPEVK------ 180
            .:.:|..::....|:.|..          :|.|:.....|..|...::.||:::..|::      
 Worm   187 MTELELIMLDWFGKMIGLPAEFLPLTENGKGGGVIQSSASECNFVTLLAARFEVMKELRQRFPFV 251

  Fly   181 TSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGE 245
            ..|:. :..|:.:.|.|:|.|..||..   :|......:.|:.:.::..|.|...|.|.:..|..
 Worm   252 EEGLL-LSKLIAYCSKEAHSSVEKACM---IGMVKLRILETDSKFRLRGDTLRNAIQEDRNLGLI 312

  Fly   246 PFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWN 310
            ||||:.|.|||...:||.::....:.:.:.|||||||...|:|.:..:.|.|:.|:|.|.||:.|
 Worm   313 PFFVSTTLGTTSCCSFDVLSEIGPICKENELWLHVDAAYSGSAFICPEFRPLMNGIEYAMSFNTN 377

  Fly   311 PHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWL 375
            |:|.:.....||....|:..:|.:   :.....|:.|..:.|.|.|..:..:...|:..:.|.|.
 Worm   378 PNKWLLINFDCSTMWVRDRFKLTQ---ALVVDPLYLQHSWMDKSIDYRHWGIPLSRRFRSLKLWF 439

  Fly   376 MLKARGYGKYGLM--VDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEE 438
            ::  |.||..||.  :...:.:|:.:|..|  |.|....::.|.....|||       |:..::|
 Worm   440 VI--RMYGIDGLQKYIREHVRLAKKMETLL--RADAKFEIVNEVIMGLVCF-------RMKGDDE 493

  Fly   439  438
             Worm   494  493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 88/366 (24%)
tdc-1NP_495743.1 Pyridoxal_deC 111..489 CDD:278699 96/401 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.