DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Gad2

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_032104.2 Gene:Gad2 MGIID:95634 Length:585 Species:Mus musculus

Alignment Length:499 Identity:213/500 (43%)
Similarity:316/500 (63%) Gaps:21/500 (4%)


  Fly    16 DGLMDDWKILENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKLKELINLKVRETENCSLAEIE 79
            ||.......|::|.::|.:   :.|  :.:|:. |::.|..|::|.:..|.::.:... :|.||.
Mouse   102 DGERPTLAFLQDVMNILLQ---YVV--KSFDRSTKVIDFHYPNELLQEYNWELADQPQ-NLEEIL 160

  Fly    80 ELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATIC 144
            ..||..:.|::||.|.|:.|||...||..|||...:|...|.:.:|||:||||.|:|...:..:.
Mouse   161 THCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMR 225

  Fly   145 KLAGYK--EGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAAN 207
            ::.|:.  .|||||:|||:.||||.|::||||:.||||..||..:..|:.|||:.||:|..|.|.
Mouse   226 EIIGWPGGSGDGIFSPGGAISNMYAMLIARYKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAA 290

  Fly   208 WLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFFVNCTAGTTVLGAFDDINGAADVTE 272
            .||:|:.:.:.::.:|||:|:..|||.:|.|.|.:|..||.|:.||||||.||||.:...||:.:
Mouse   291 ALGIGTDSVILIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICK 355

  Fly   273 RHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCN 337
            ::.:|:||||..||..|:|.|::..::|:|||||.:|||||.:|.|||||..|.||.| |::.||
Mouse   356 KYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEG-LMQSCN 419

  Fly   338 STEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGK 402
            ...|.|||||||.||:|||||:|::||||.:|.||.|||.:|:|...:...:|..:.:|..|...
Mouse   420 QMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEYLYTI 484

  Fly   403 LRQRGDRFRLVI---PEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLM 464
            ::.| :.:.:|.   |:|  :||||||:|.::|...:.|  |..|||..|||.||.:|...||.|
Mouse   485 IKNR-EGYEMVFDGKPQH--TNVCFWFVPPSLRTLEDNE--ERMSRLSKVAPVIKARMMEYGTTM 544

  Fly   465 IGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEKI 508
            :.|.||..|  .||||||.: .|....:::||:::||||||:.:
Mouse   545 VSYQPLGDK--VNFFRMVIS-NPAATHQDIDFLIEEIERLGQDL 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 189/412 (46%)
Gad2NP_032104.2 Pyridoxal_deC 138..509 CDD:278699 169/376 (45%)
Substrate binding. {ECO:0000250} 181..183 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.