DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5618 and Gad1

Sequence 1:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_017171083.1 Gene:Gad1 MGIID:95632 Length:621 Species:Mus musculus

Alignment Length:521 Identity:227/522 (43%)
Similarity:319/522 (61%) Gaps:52/522 (10%)


  Fly    23 KILENVFHLLRKEDTFCVDPQKWDKQ-KIVPFLQPDKL---KELINLKVRETENCSLAEIEELCQ 83
            ::::.:.:.:||  ||       |:. |::.|..|.:|   .|..||::.:... ||.:|...|:
Mouse   118 EVVDILLNYVRK--TF-------DRSTKVLDFHHPHQLLEGMEGFNLELSDHPE-SLEQILVDCR 172

  Fly    84 QVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFSLIETEVIATICKLAG 148
            ..:.|.|:|.|.||.|||...||..||||..:|...|.:.:|||:||||.|:|...:..:.::.|
Mouse   173 DTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVG 237

  Fly   149 Y--KEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSD--------------- 196
            :  |:|||||:|||:.||||.::.||||..|||||.||..:..||||||:               
Mouse   238 WSNKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHVSWGLWRVGCDGFQ 302

  Fly   197 -------------ESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGGEPFF 248
                         :||||..||...||.|:.|.:.::.||||:::..||||||.:||.:|..|.:
Mouse   303 GTMQLLTSSIPLLQSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILDAKQKGYVPLY 367

  Fly   249 VNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHK 313
            ||.||||||.||||.|...||:.|::.|||||||..||..|:|.|:|..::|:|||||.:|||||
Mouse   368 VNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHK 432

  Fly   314 TIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLK 378
            .:|..||||..|.:|.| :|:.||...|.||||.||.||||||||:|::||||.:|.||||||.|
Mouse   433 MMGVLLQCSAILVKEKG-ILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWK 496

  Fly   379 ARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIP-EHEYSNVCFWFIPKAMRVSSEEETPEW 442
            |:|...:...::..:.:|..|..|::.| :.|.:|.. |.|::|||||:||:::|  ...::||.
Mouse   497 AKGTVGFENQINKCLELADYLYAKIKNR-EEFEMVFDGEPEHTNVCFWYIPQSLR--GVPDSPER 558

  Fly   443 WSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFTCFPILKSKELDFILDEIERLGEK 507
            ..:|:.||||||..|..|||.|:||.|...|  .||||||.: .|.....::||:::||||||:.
Mouse   559 REKLHRVAPKIKALMMESGTTMVGYQPQGDK--ANFFRMVIS-NPAATQSDIDFLIEEIERLGQD 620

  Fly   508 I 508
            :
Mouse   621 L 621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 204/438 (47%)
Gad1XP_017171083.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.